BLASTX nr result
ID: Glycyrrhiza36_contig00006829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00006829 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004486409.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 2e-29 GAU44626.1 hypothetical protein TSUD_379050 [Trifolium subterran... 113 2e-27 XP_003594404.1 PPR containing plant-like protein [Medicago trunc... 103 8e-24 XP_019451405.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 9e-15 XP_014517170.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 KRG93583.1 hypothetical protein GLYMA_19G026400 [Glycine max] 70 6e-12 XP_016204334.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 XP_015954989.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 68 2e-11 XP_015967339.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 2e-11 KHN38680.1 Pentatricopeptide repeat-containing protein, mitochon... 68 3e-11 XP_014627014.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 3e-11 XP_014619628.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 3e-11 OIW06380.1 hypothetical protein TanjilG_15025 [Lupinus angustifo... 67 5e-11 KHN48790.1 Pentatricopeptide repeat-containing protein, mitochon... 67 7e-11 XP_016189107.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_007159287.1 hypothetical protein PHAVU_002G225300g [Phaseolus... 65 3e-10 XP_017436199.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-09 XP_009347603.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_009371642.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 >XP_004486409.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial [Cicer arietinum] Length = 528 Score = 119 bits (297), Expect = 2e-29 Identities = 64/90 (71%), Positives = 70/90 (77%), Gaps = 1/90 (1%) Frame = +3 Query: 12 MRAVARPLMSNCSPHFPSPSF-DQHQLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRR 188 MRAVARPL SNCS H S S D HQLLH IS+LNSL+TSY+RRG + AWNLFR LRR Sbjct: 2 MRAVARPLKSNCSSHSQSLSLSDHHQLLHRPISELNSLITSYVRRGQSIIAWNLFRSLRR 61 Query: 189 VRSSDIDAYTFTRLLRPSPLPLGKQLHAQM 278 +R SDIDA+TFT LLRPS LGKQ HAQM Sbjct: 62 LR-SDIDAHTFTPLLRPSSPSLGKQFHAQM 90 >GAU44626.1 hypothetical protein TSUD_379050 [Trifolium subterraneum] Length = 521 Score = 113 bits (282), Expect = 2e-27 Identities = 61/91 (67%), Positives = 69/91 (75%) Frame = +3 Query: 6 MWMRAVARPLMSNCSPHFPSPSFDQHQLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLR 185 M MRA +RPL SN S HF S S D HQLLH IS+LNS++TSY+RRG +SAWNLF LR Sbjct: 1 MLMRAASRPLTSNSSSHFHSLS-DHHQLLHRPISELNSIITSYVRRGQSISAWNLFLSLR 59 Query: 186 RVRSSDIDAYTFTRLLRPSPLPLGKQLHAQM 278 +R SDIDA+TFT LLRPS LGKQ HAQM Sbjct: 60 GIR-SDIDAHTFTPLLRPSSPSLGKQFHAQM 89 >XP_003594404.1 PPR containing plant-like protein [Medicago truncatula] AES64655.1 PPR containing plant-like protein [Medicago truncatula] Length = 516 Score = 103 bits (256), Expect = 8e-24 Identities = 59/91 (64%), Positives = 69/91 (75%) Frame = +3 Query: 6 MWMRAVARPLMSNCSPHFPSPSFDQHQLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLR 185 M RAVA+PL S F S S D HQLLH IS+LNSL+TSYIRRG P+SA+NLF LR Sbjct: 1 MLKRAVAQPLSS-----FHSQS-DHHQLLHRPISELNSLITSYIRRGHPISAFNLFLSLR 54 Query: 186 RVRSSDIDAYTFTRLLRPSPLPLGKQLHAQM 278 R+R D+D++TFT LLRPSP LGKQLH+QM Sbjct: 55 RIR-IDLDSHTFTPLLRPSPTSLGKQLHSQM 84 >XP_019451405.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial [Lupinus angustifolius] Length = 534 Score = 77.8 bits (190), Expect = 9e-15 Identities = 47/90 (52%), Positives = 61/90 (67%), Gaps = 8/90 (8%) Frame = +3 Query: 33 LMSNCSPHFPSPSFDQH----QLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSS 200 L S+C HFPS +F H ++LH IS +NSL+TSY+RRG LSAW LF + +VR S Sbjct: 14 LTSSC--HFPSNTFSTHIMFDEMLHRDISSVNSLITSYVRRGHSLSAWALFHHVHQVR-S 70 Query: 201 DIDAYTFTRLLRP-SPLPL---GKQLHAQM 278 ++DA+TFT +LR S LP GKQ+HA M Sbjct: 71 NLDAFTFTPVLRACSLLPFANRGKQVHAHM 100 >XP_014517170.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial [Vigna radiata var. radiata] Length = 541 Score = 70.9 bits (172), Expect = 2e-12 Identities = 42/79 (53%), Positives = 51/79 (64%), Gaps = 4/79 (5%) Frame = +3 Query: 54 HFPSPSFDQHQLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLL 233 +F S S Q+ ISQ NSL+ S +RRGDP+SAW LF LRR R +D+DAYTFT +L Sbjct: 37 NFSSSSLTQY------ISQTNSLIASLVRRGDPVSAWILFHSLRRAR-ADVDAYTFTSVL 89 Query: 234 RPSPL----PLGKQLHAQM 278 R L LG Q+HAQM Sbjct: 90 RACTLLHISQLGTQVHAQM 108 >KRG93583.1 hypothetical protein GLYMA_19G026400 [Glycine max] Length = 542 Score = 69.7 bits (169), Expect = 6e-12 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 8/91 (8%) Frame = +3 Query: 30 PLMSNCSPHFPSPSFDQHQLLHLT-ISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDI 206 P + + + P F H+L L+ ISQ NSL+ SY+RRGDP+SA LF LRR SD+ Sbjct: 20 PQLCSLLDRYSQPLF--HELFTLSHISQTNSLIASYVRRGDPVSALTLFHSLRRRAHSDV 77 Query: 207 --DAYTFTRLLRPSPL-----PLGKQLHAQM 278 DAYTFT +LR S L G Q+HAQM Sbjct: 78 VADAYTFTSILRASSLLRVSGQFGTQVHAQM 108 >XP_016204334.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] Length = 504 Score = 68.9 bits (167), Expect = 1e-11 Identities = 39/69 (56%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +3 Query: 84 QLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRP-SPLPL-- 254 ++LH IS +NSL+TSY+RRGD +AW LF +RR R SD+DA+TFT +LR S LPL Sbjct: 4 EMLHRDISHVNSLITSYVRRGDLATAWTLFCDVRRTR-SDLDAHTFTPVLRACSLLPLSK 62 Query: 255 -GKQLHAQM 278 GKQ+H M Sbjct: 63 RGKQVHTHM 71 >XP_015954989.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis duranensis] Length = 496 Score = 68.2 bits (165), Expect = 2e-11 Identities = 39/69 (56%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +3 Query: 84 QLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRP-SPLPL-- 254 ++LH IS +NSL+TSY+RRGD +AW LF +RR R SD+DA+TFT +LR S LPL Sbjct: 4 EMLHRDISLVNSLITSYVRRGDLAAAWTLFCDVRRTR-SDLDAHTFTPVLRACSLLPLSK 62 Query: 255 -GKQLHAQM 278 GKQ+H M Sbjct: 63 RGKQVHTHM 71 >XP_015967339.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis duranensis] Length = 497 Score = 68.2 bits (165), Expect = 2e-11 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 4/68 (5%) Frame = +3 Query: 87 LLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRP-SPLPL--- 254 +LH IS +NSL+TSY+RRGD +AW LF +RR R SD+DA+TFT +LR S LPL Sbjct: 1 MLHRDISHVNSLITSYVRRGDLATAWTLFCDVRRTR-SDLDAHTFTPVLRACSLLPLSKR 59 Query: 255 GKQLHAQM 278 GKQ+H M Sbjct: 60 GKQVHTHM 67 >KHN38680.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 547 Score = 67.8 bits (164), Expect = 3e-11 Identities = 42/81 (51%), Positives = 49/81 (60%), Gaps = 11/81 (13%) Frame = +3 Query: 69 SFDQHQLLHL----TISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDI--DAYTFTRL 230 SF L H+ ISQ NSL+ SY+RRGDP+SA LF LRR SD+ DAYTFT + Sbjct: 33 SFTNSSLSHVHFPSDISQTNSLIASYVRRGDPVSALTLFHSLRRRAHSDVVADAYTFTSI 92 Query: 231 LRPSPL-----PLGKQLHAQM 278 LR S L G Q+HAQM Sbjct: 93 LRASSLLRVSGQFGTQVHAQM 113 >XP_014627014.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like, partial [Glycine max] Length = 547 Score = 67.8 bits (164), Expect = 3e-11 Identities = 42/81 (51%), Positives = 49/81 (60%), Gaps = 11/81 (13%) Frame = +3 Query: 69 SFDQHQLLHL----TISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDI--DAYTFTRL 230 SF L H+ ISQ NSL+ SY+RRGDP+SA LF LRR SD+ DAYTFT + Sbjct: 33 SFTNSSLSHVHFPSDISQTNSLIASYVRRGDPVSALTLFHSLRRRAHSDVVADAYTFTSI 92 Query: 231 LRPSPL-----PLGKQLHAQM 278 LR S L G Q+HAQM Sbjct: 93 LRASSLLRVSGQFGTQVHAQM 113 >XP_014619628.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Glycine max] XP_014619629.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Glycine max] XP_014619630.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Glycine max] XP_014619631.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Glycine max] KRH30526.1 hypothetical protein GLYMA_11G190300 [Glycine max] Length = 547 Score = 67.8 bits (164), Expect = 3e-11 Identities = 42/81 (51%), Positives = 49/81 (60%), Gaps = 11/81 (13%) Frame = +3 Query: 69 SFDQHQLLHL----TISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDI--DAYTFTRL 230 SF L H+ ISQ NSL+ SY+RRGDP+SA LF LRR SD+ DAYTFT + Sbjct: 33 SFTNSSLSHVHFPSDISQTNSLIASYVRRGDPVSALTLFHSLRRRAHSDVVADAYTFTSI 92 Query: 231 LRPSPL-----PLGKQLHAQM 278 LR S L G Q+HAQM Sbjct: 93 LRASSLLRVSGQFGTQVHAQM 113 >OIW06380.1 hypothetical protein TanjilG_15025 [Lupinus angustifolius] Length = 501 Score = 67.0 bits (162), Expect = 5e-11 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 4/68 (5%) Frame = +3 Query: 87 LLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRP-SPLPL--- 254 +LH IS +NSL+TSY+RRG LSAW LF + +VR S++DA+TFT +LR S LP Sbjct: 1 MLHRDISSVNSLITSYVRRGHSLSAWALFHHVHQVR-SNLDAFTFTPVLRACSLLPFANR 59 Query: 255 GKQLHAQM 278 GKQ+HA M Sbjct: 60 GKQVHAHM 67 >KHN48790.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 508 Score = 66.6 bits (161), Expect = 7e-11 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 7/66 (10%) Frame = +3 Query: 102 ISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDI--DAYTFTRLLRPSPL-----PLGK 260 ISQ NSL+ SY+RRGDP+SA LF LRR SD+ DAYTFT +LR S L G Sbjct: 9 ISQTNSLIASYVRRGDPVSALTLFHSLRRRAHSDVVADAYTFTSILRASSLLRVSGQFGT 68 Query: 261 QLHAQM 278 Q+HAQM Sbjct: 69 QVHAQM 74 >XP_016189107.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] XP_016189108.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] XP_016189109.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] XP_016189110.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] XP_016189111.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Arachis ipaensis] Length = 496 Score = 65.9 bits (159), Expect = 1e-10 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 4/69 (5%) Frame = +3 Query: 84 QLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRP-SPLPL-- 254 ++LH I +NSL+TSY+RRGD +AW LF +RR R SD+DA+TFT +LR S LPL Sbjct: 4 EMLHRDIFLVNSLITSYVRRGDLAAAWTLFCDVRRTR-SDLDAHTFTPVLRACSLLPLSK 62 Query: 255 -GKQLHAQM 278 GKQ+H M Sbjct: 63 RGKQVHTHM 71 >XP_007159287.1 hypothetical protein PHAVU_002G225300g [Phaseolus vulgaris] ESW31281.1 hypothetical protein PHAVU_002G225300g [Phaseolus vulgaris] Length = 551 Score = 65.1 bits (157), Expect = 3e-10 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Frame = +3 Query: 102 ISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLLRPSPL----PLGKQLH 269 ISQ N L+ S++RRGDP+SAW LF LRR R+ +DAYTFT +LR L LG Q+H Sbjct: 55 ISQTNYLIASHVRRGDPVSAWILFHSLRRARAV-VDAYTFTSVLRACTLLHVSQLGIQVH 113 Query: 270 AQM 278 AQM Sbjct: 114 AQM 116 >XP_017436199.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial [Vigna angularis] XP_017436200.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial [Vigna angularis] KOM53222.1 hypothetical protein LR48_Vigan09g188100 [Vigna angularis] BAT87624.1 hypothetical protein VIGAN_05101300 [Vigna angularis var. angularis] Length = 541 Score = 63.2 bits (152), Expect = 1e-09 Identities = 38/79 (48%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = +3 Query: 54 HFPSPSFDQHQLLHLTISQLNSLLTSYIRRGDPLSAWNLFRRLRRVRSSDIDAYTFTRLL 233 +F S S Q+ ISQ N L+ ++RRGDP+SAW LF L R +D+DAYTFT +L Sbjct: 37 NFSSSSLTQN------ISQTNFLIALHVRRGDPVSAWILFHSLHRAH-ADVDAYTFTSVL 89 Query: 234 RPSPL----PLGKQLHAQM 278 R L LG Q+HAQM Sbjct: 90 RACTLLHISQLGTQVHAQM 108 >XP_009347603.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Pyrus x bretschneideri] XP_009347612.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Pyrus x bretschneideri] Length = 530 Score = 54.7 bits (130), Expect = 1e-06 Identities = 42/101 (41%), Positives = 53/101 (52%), Gaps = 12/101 (11%) Frame = +3 Query: 12 MRAVARPLMSNCSPHFPSP----SFDQHQLL----HLTISQLNSLLTSYIRRGDPLSAWN 167 M A+ RP+ S H P+ F H L H I LNSLL SY R G S W Sbjct: 1 MAALTRPIRSL---HLPAKCYFNGFHTHHLFDETSHRDIYSLNSLLASYTRNGQFSSTWA 57 Query: 168 LFRRLRRVRSSDIDAYTFTRLL---RPSPLP-LGKQLHAQM 278 LF R+ R++ SD++AYTFT +L R P P G+Q+H M Sbjct: 58 LFCRVHRLK-SDLNAYTFTPVLGACRALPRPERGRQVHCLM 97 >XP_009371642.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66500, mitochondrial-like [Pyrus x bretschneideri] Length = 530 Score = 54.7 bits (130), Expect = 1e-06 Identities = 42/101 (41%), Positives = 53/101 (52%), Gaps = 12/101 (11%) Frame = +3 Query: 12 MRAVARPLMSNCSPHFPSP----SFDQHQLL----HLTISQLNSLLTSYIRRGDPLSAWN 167 M A+ RP+ S H P+ F H L H I LNSLL SY R G S W Sbjct: 1 MAALTRPIRSL---HLPAKCYFNGFHTHHLFDETSHRDIYSLNSLLASYTRNGQFSSTWA 57 Query: 168 LFRRLRRVRSSDIDAYTFTRLL---RPSPLP-LGKQLHAQM 278 LF R+ R++ SD++AYTFT +L R P P G+Q+H M Sbjct: 58 LFCRVHRLK-SDLNAYTFTPVLGACRALPRPERGRQVHCLM 97