BLASTX nr result
ID: Glycyrrhiza36_contig00006796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00006796 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EFS39028.1 hypothetical protein HMPREF9574_00607 [Propionibacter... 217 1e-71 EBA38630.1 hypothetical protein COLAER_02284 [Collinsella aerofa... 153 2e-45 EDN81767.1 hypothetical protein ACTODO_00001 [Actinomyces odonto... 142 2e-42 EBA39187.1 hypothetical protein COLAER_01802 [Collinsella aerofa... 138 4e-40 EFE75472.1 conserved hypothetical protein, partial [Streptomyces... 135 2e-39 EFE84355.1 conserved hypothetical protein, partial [Streptomyces... 135 2e-39 EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] 134 4e-39 EDY62143.2 conserved hypothetical protein [Streptomyces pristina... 134 6e-39 EFH32042.1 conserved hypothetical protein [Streptomyces pristina... 134 1e-38 EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] 132 4e-38 EFE81978.1 conserved hypothetical protein [Streptomyces albus J1... 133 4e-38 EDY48148.1 conserved hypothetical protein [Streptomyces clavulig... 131 7e-38 EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1]... 131 7e-38 EFL24236.1 conserved hypothetical protein, partial [Streptomyces... 130 1e-37 EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosp... 130 2e-37 EFE70731.1 LOW QUALITY PROTEIN: conserved hypothetical protein, ... 131 2e-37 EFL02127.1 conserved hypothetical protein [Streptomyces sp. SPB78] 130 3e-37 EDN81768.1 hypothetical protein ACTODO_00002 [Actinomyces odonto... 126 8e-36 EFH28520.1 conserved hypothetical protein [Streptomyces sviceus ... 125 5e-35 CKG78254.1 Uncharacterised protein [Corynebacterium diphtheriae]... 123 7e-35 >EFS39028.1 hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 217 bits (552), Expect = 1e-71 Identities = 101/104 (97%), Positives = 102/104 (98%) Frame = +2 Query: 2 SSARVVRCWVKSRNERNPCLMLPARYGGDSWETAGVNSEEGGDDVKSSCPLCPGLHACYN 181 SSARVVRCWVKSRNERNPC +LPARYGGDS ETAGVNSEEGGDDVKSSCPLCPGLHACYN Sbjct: 2 SSARVVRCWVKSRNERNPCSLLPARYGGDSVETAGVNSEEGGDDVKSSCPLCPGLHACYN 61 Query: 182 GWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR 313 GWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR Sbjct: 62 GWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR 105 >EBA38630.1 hypothetical protein COLAER_02284 [Collinsella aerofaciens ATCC 25986] EBA38843.1 hypothetical protein COLAER_01925 [Collinsella aerofaciens ATCC 25986] EBA39061.1 hypothetical protein COLAER_01671 [Collinsella aerofaciens ATCC 25986] Length = 160 Score = 153 bits (386), Expect = 2e-45 Identities = 76/101 (75%), Positives = 81/101 (80%) Frame = +2 Query: 2 SSARVVRCWVKSRNERNPCLMLPARYGGDSWETAGVNSEEGGDDVKSSCPLCPGLHACYN 181 SSARVVRCWVKSRNERNP +LP+ G+ TA V +EEGGDDVKSSCPLCPGLH CYN Sbjct: 21 SSARVVRCWVKSRNERNPRRVLPSGDAGNPRGTAAVKAEEGGDDVKSSCPLCPGLHTCYN 80 Query: 182 GWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSA 304 G YR EGERI ESR QFGLG+ATRPHEVGVASNR SA Sbjct: 81 GRYRGMPPREGERIPESRPQFGLGAATRPHEVGVASNRGSA 121 >EDN81767.1 hypothetical protein ACTODO_00001 [Actinomyces odontolyticus ATCC 17982] Length = 88 Score = 142 bits (359), Expect = 2e-42 Identities = 66/74 (89%), Positives = 66/74 (89%) Frame = +2 Query: 2 SSARVVRCWVKSRNERNPCLMLPARYGGDSWETAGVNSEEGGDDVKSSCPLCPGLHACYN 181 SSARVVRCWVKSRNERNPC MLPAR GGDSW TAGVNSEEGGDDVKSSCPLC GLHACYN Sbjct: 14 SSARVVRCWVKSRNERNPCPMLPARDGGDSWGTAGVNSEEGGDDVKSSCPLCLGLHACYN 73 Query: 182 GWYREWRACEGERI 223 GWYR R CE ERI Sbjct: 74 GWYRGLRYCEVERI 87 >EBA39187.1 hypothetical protein COLAER_01802 [Collinsella aerofaciens ATCC 25986] Length = 115 Score = 138 bits (347), Expect = 4e-40 Identities = 67/91 (73%), Positives = 72/91 (79%) Frame = +2 Query: 2 SSARVVRCWVKSRNERNPCLMLPARYGGDSWETAGVNSEEGGDDVKSSCPLCPGLHACYN 181 SSARVVRCWVKSRNERNP +LP+ G+ TA V +EEGGDDVKSSCPLCPGLH CYN Sbjct: 21 SSARVVRCWVKSRNERNPRRVLPSGDAGNPRGTAAVKAEEGGDDVKSSCPLCPGLHTCYN 80 Query: 182 GWYREWRACEGERISESRSQFGLGSATRPHE 274 G YR EGERI ESR QFGLG+ATRPHE Sbjct: 81 GRYRGMPPREGERIPESRPQFGLGAATRPHE 111 >EFE75472.1 conserved hypothetical protein, partial [Streptomyces roseosporus NRRL 15998] Length = 96 Score = 135 bits (341), Expect = 2e-39 Identities = 68/86 (79%), Positives = 69/86 (80%) Frame = +2 Query: 56 CLMLPARYGGDSWETAGVNSEEGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESR 235 C R GDS ETAGVNSEEGGDDVKSSCPLC GLH CYNG Y E R E ERIS+SR Sbjct: 11 CCQHALRRDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSR 70 Query: 236 SQFGLGSATRPHEVGVASNRRSATLR 313 SQFGLGSATRPHEVGVASNRRSA LR Sbjct: 71 SQFGLGSATRPHEVGVASNRRSALLR 96 >EFE84355.1 conserved hypothetical protein, partial [Streptomyces albus J1074] Length = 87 Score = 135 bits (339), Expect = 2e-39 Identities = 68/85 (80%), Positives = 72/85 (84%) Frame = +3 Query: 75 VMVGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWG 254 V++GTHGR PGSTRRKVG TSSHHAPYV G T ATMAGT S + R SES+KAGLSSDWG Sbjct: 3 VVLGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWG 62 Query: 255 LQLDLMKSESLVIADQQRCGEYVPG 329 LQLD MKSESLVIADQ CGEYVPG Sbjct: 63 LQLDPMKSESLVIADQHCCGEYVPG 87 >EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 134 bits (338), Expect = 4e-39 Identities = 68/83 (81%), Positives = 71/83 (85%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTHGR PGSTRRKVG TSSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSESLVIADQ CGEYVPG Sbjct: 61 LDPMKSESLVIADQHCCGEYVPG 83 >EDY62143.2 conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 134 bits (337), Expect = 6e-39 Identities = 68/83 (81%), Positives = 71/83 (85%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH RLPGSTRRKVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EFH32042.1 conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 121 Score = 134 bits (337), Expect = 1e-38 Identities = 68/83 (81%), Positives = 71/83 (85%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH RLPGSTRRKVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] Length = 95 Score = 132 bits (332), Expect = 4e-38 Identities = 67/83 (80%), Positives = 70/83 (84%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTHGR PGSTRRKVG TSSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EFE81978.1 conserved hypothetical protein [Streptomyces albus J1074] Length = 121 Score = 133 bits (334), Expect = 4e-38 Identities = 67/83 (80%), Positives = 70/83 (84%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTHGR PGSTRRKVG TSSHHAPYV G T ATMAGT S + R SES+KAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSESLVIADQ CGEYVPG Sbjct: 61 LDPMKSESLVIADQHCCGEYVPG 83 >EDY48148.1 conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 131 bits (330), Expect = 7e-38 Identities = 67/83 (80%), Positives = 70/83 (84%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH R PGSTRRKVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1] EFL16481.1 conserved hypothetical protein [Streptomyces sp. C] Length = 95 Score = 131 bits (330), Expect = 7e-38 Identities = 67/83 (80%), Positives = 70/83 (84%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH R PGSTRRKVG TSSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSESLVIADQ CGEYVPG Sbjct: 61 LDPMKSESLVIADQHCCGEYVPG 83 >EFL24236.1 conserved hypothetical protein, partial [Streptomyces himastatinicus ATCC 53653] Length = 84 Score = 130 bits (328), Expect = 1e-37 Identities = 67/83 (80%), Positives = 69/83 (83%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH RLPGSTRRKVG TSSHHAPYV G T ATMAGT S E VR SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCEAVRWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MK E LVIADQ CGEYVPG Sbjct: 61 LDPMKLELLVIADQHCCGEYVPG 83 >EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 130 bits (327), Expect = 2e-37 Identities = 66/83 (79%), Positives = 69/83 (83%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH RLPGSTRRKVG TSSHHAPYV G T ATMAGT S + R SES+KAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EFE70731.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces ghanaensis ATCC 14672] Length = 134 Score = 131 bits (330), Expect = 2e-37 Identities = 66/77 (85%), Positives = 67/77 (87%) Frame = +2 Query: 83 GDSWETAGVNSEEGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSAT 262 GDS ETAGVNSEEGGDDVKSSCPLC GLH CYNG Y E R E ERIS+SRSQFGLGSAT Sbjct: 12 GDSRETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRYREVERISKSRSQFGLGSAT 71 Query: 263 RPHEVGVASNRRSATLR 313 RPHEVGVASNRRSA LR Sbjct: 72 RPHEVGVASNRRSALLR 88 >EFL02127.1 conserved hypothetical protein [Streptomyces sp. SPB78] Length = 121 Score = 130 bits (328), Expect = 3e-37 Identities = 66/83 (79%), Positives = 69/83 (83%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTHGR PGSTRRKVG TSSHHAPYV G T ATMAGT S + R SES+KAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >EDN81768.1 hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 126 bits (316), Expect = 8e-36 Identities = 63/77 (81%), Positives = 66/77 (85%) Frame = +3 Query: 99 LPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKS 278 +PG TRRKVGMTS+HHAPYV GFTHATMAGTE + VR SES KA LSSDWGLQLD MK Sbjct: 1 MPGLTRRKVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKV 60 Query: 279 ESLVIADQQRCGEYVPG 329 ESLVIADQQRCGEYV G Sbjct: 61 ESLVIADQQRCGEYVLG 77 >EFH28520.1 conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 137 Score = 125 bits (315), Expect = 5e-35 Identities = 65/83 (78%), Positives = 68/83 (81%) Frame = +3 Query: 81 VGTHGRLPGSTRRKVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQ 260 +GTH R PGSTRRKVG TSSHHAPYV G T ATMAGT S + VR SES+KA LSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKACLSSDWGLQ 60 Query: 261 LDLMKSESLVIADQQRCGEYVPG 329 LD MKSE LVIADQ CGEYVPG Sbjct: 61 LDPMKSELLVIADQHCCGEYVPG 83 >CKG78254.1 Uncharacterised protein [Corynebacterium diphtheriae] CKG91802.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH11103.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH18086.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH22304.1 Uncharacterised protein [Corynebacterium diphtheriae] Length = 79 Score = 123 bits (309), Expect = 7e-35 Identities = 60/67 (89%), Positives = 61/67 (91%) Frame = +3 Query: 129 MTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIADQQR 308 MTS+HHAPYVQGFTHATM GT EPVRVSES KAGLSSDWGLQLD MKSESLVIADQQR Sbjct: 1 MTSNHHAPYVQGFTHATMVGTTRCEPVRVSESLKAGLSSDWGLQLDPMKSESLVIADQQR 60 Query: 309 CGEYVPG 329 CGEYVPG Sbjct: 61 CGEYVPG 67