BLASTX nr result
ID: Glycyrrhiza36_contig00006527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00006527 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-cont... 66 4e-10 XP_003630975.1 PPR containing plant-like protein [Medicago trunc... 57 6e-07 >XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X1 [Cicer arietinum] XP_012572060.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X2 [Cicer arietinum] Length = 705 Score = 66.2 bits (160), Expect = 4e-10 Identities = 38/87 (43%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = +1 Query: 58 TEQVITRILRNPNRRVS--TRQAKQLHGHVVRTKGTSHPDNXXXXXXXXXXXXXXXXXXX 231 TE +IT ILRNP R VS TRQAKQLH H+V+TKGT H DN Sbjct: 5 TEHIITNILRNPKRTVSVSTRQAKQLHAHIVKTKGTFHDDNILVLSLYSNLNLLHHSLHL 64 Query: 232 XXXXXXXXXXXXXXXXIKCYTSHNLPH 312 IKCYTSH+L H Sbjct: 65 FNSLPSPPPPLAWSSLIKCYTSHSLLH 91 >XP_003630975.1 PPR containing plant-like protein [Medicago truncatula] AET05451.1 PPR containing plant-like protein [Medicago truncatula] Length = 701 Score = 57.4 bits (137), Expect = 6e-07 Identities = 35/88 (39%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = +1 Query: 58 TEQVITRILRN-PNRR--VSTRQAKQLHGHVVRTKGTSHPDNXXXXXXXXXXXXXXXXXX 228 T+ I++ILR PN+ VSTRQAKQLH H+V+TKGT H DN Sbjct: 5 TQHTISKILRKTPNKTLSVSTRQAKQLHAHIVKTKGTLHSDNILVLSLYSNLNLLQHSLH 64 Query: 229 XXXXXXXXXXXXXXXXXIKCYTSHNLPH 312 IKCYTSH+L H Sbjct: 65 LFNSLPSPPPPLAWSSIIKCYTSHSLLH 92