BLASTX nr result
ID: Glycyrrhiza36_contig00006414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00006414 (549 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004488976.1 PREDICTED: protein SRG1-like [Cicer arietinum] 61 1e-07 KRH27437.1 hypothetical protein GLYMA_12G235100 [Glycine max] 57 2e-06 KHN19470.1 Protein SRG1 [Glycine soja] 57 2e-06 NP_001242069.1 uncharacterized protein LOC100777264 [Glycine max... 57 2e-06 >XP_004488976.1 PREDICTED: protein SRG1-like [Cicer arietinum] Length = 355 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 548 SEQTPARFKRITLKEFLRNMFAHKLDGKSCVDAMRI 441 +E+TPARFKRI LKEFLRN+FA KLDGKS VDA+RI Sbjct: 320 NEETPARFKRIGLKEFLRNLFARKLDGKSNVDALRI 355 >KRH27437.1 hypothetical protein GLYMA_12G235100 [Glycine max] Length = 358 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 548 SEQTPARFKRITLKEFLRNMFAHKLDGKSCVDAMRI 441 +E+TPARFKRI LKEFL+N+FA KLDGKS +D +RI Sbjct: 323 TEKTPARFKRIELKEFLKNLFARKLDGKSYLDTLRI 358 >KHN19470.1 Protein SRG1 [Glycine soja] Length = 358 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 548 SEQTPARFKRITLKEFLRNMFAHKLDGKSCVDAMRI 441 +E+TPARFKRI LKEFL+N+FA KLDGKS +D +RI Sbjct: 323 TEKTPARFKRIELKEFLKNLFARKLDGKSYLDTLRI 358 >NP_001242069.1 uncharacterized protein LOC100777264 [Glycine max] ACU23067.1 unknown [Glycine max] Length = 358 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 548 SEQTPARFKRITLKEFLRNMFAHKLDGKSCVDAMRI 441 +E+TPARFKRI LKEFL+N+FA KLDGKS +D +RI Sbjct: 323 TEKTPARFKRIELKEFLKNLFARKLDGKSYLDTLRI 358