BLASTX nr result
ID: Glycyrrhiza36_contig00004511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00004511 (563 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572248.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 73 2e-12 AER26535.1 fk506-binding protein [Carica papaya] 72 4e-12 XP_003630070.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Me... 69 3e-11 AFK46310.1 unknown [Lotus japonicus] 69 4e-11 XP_015956013.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 68 8e-11 EOX92195.1 FK506-binding protein 16-2 isoform 3 [Theobroma cacao] 68 9e-11 XP_002281281.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 68 1e-10 XP_007048036.2 PREDICTED: photosynthetic NDH subunit of lumenal ... 68 1e-10 EOX92193.1 FK506-binding protein 16-2 isoform 1 [Theobroma cacao... 68 1e-10 XP_012492235.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 68 1e-10 XP_016679373.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 68 1e-10 OMP02488.1 hypothetical protein COLO4_11054 [Corchorus olitorius] 68 2e-10 OMO55996.1 hypothetical protein CCACVL1_26827 [Corchorus capsula... 68 2e-10 EEF33399.1 fk506-binding protein, putative [Ricinus communis] 66 2e-10 XP_015890886.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 67 3e-10 XP_002306326.1 immunophilin family protein [Populus trichocarpa]... 66 3e-10 XP_006363941.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 67 3e-10 XP_004237421.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 67 3e-10 XP_008440633.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 67 3e-10 XP_011657986.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 67 3e-10 >XP_012572248.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Cicer arietinum] XP_012572249.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Cicer arietinum] Length = 210 Score = 72.8 bits (177), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK Sbjct: 179 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 210 >AER26535.1 fk506-binding protein [Carica papaya] Length = 229 Score = 72.0 bits (175), Expect = 4e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATLLYDIKFVG+YSGNAK Sbjct: 198 PAGCFSGDCNIPGNATLLYDIKFVGIYSGNAK 229 >XP_003630070.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula] AET04546.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula] AFK40313.1 unknown [Medicago truncatula] Length = 213 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGN 474 PAGCFSGDCNIPGNATLLYDIKFVGLYSGN Sbjct: 181 PAGCFSGDCNIPGNATLLYDIKFVGLYSGN 210 >AFK46310.1 unknown [Lotus japonicus] Length = 208 Score = 68.9 bits (167), Expect = 4e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATLLYDI FVG+Y+GNAK Sbjct: 177 PAGCFSGDCNIPGNATLLYDINFVGIYNGNAK 208 >XP_015956013.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Arachis duranensis] XP_015956014.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Arachis duranensis] XP_016189929.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Arachis ipaensis] XP_016189930.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Arachis ipaensis] Length = 208 Score = 68.2 bits (165), Expect = 8e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATLLYDI FVG+YSGN K Sbjct: 177 PAGCFSGDCNIPGNATLLYDINFVGIYSGNRK 208 >EOX92195.1 FK506-binding protein 16-2 isoform 3 [Theobroma cacao] Length = 192 Score = 67.8 bits (164), Expect = 9e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 161 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 192 >XP_002281281.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Vitis vinifera] XP_010652832.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Vitis vinifera] XP_010652833.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Vitis vinifera] CBI21467.3 unnamed protein product, partial [Vitis vinifera] Length = 206 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 175 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 206 >XP_007048036.2 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Theobroma cacao] Length = 223 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 192 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 223 >EOX92193.1 FK506-binding protein 16-2 isoform 1 [Theobroma cacao] EOX92194.1 FK506-binding protein 16-2 isoform 1 [Theobroma cacao] Length = 223 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 192 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 223 >XP_012492235.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Gossypium raimondii] XP_016697826.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic-like [Gossypium hirsutum] XP_016697827.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic-like [Gossypium hirsutum] KJB44249.1 hypothetical protein B456_007G242100 [Gossypium raimondii] KJB44250.1 hypothetical protein B456_007G242100 [Gossypium raimondii] Length = 224 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 193 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 224 >XP_016679373.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic-like [Gossypium hirsutum] XP_016679378.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic-like [Gossypium hirsutum] XP_017625305.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Gossypium arboreum] KHG12197.1 Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic -like protein [Gossypium arboreum] Length = 224 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 193 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 224 >OMP02488.1 hypothetical protein COLO4_11054 [Corchorus olitorius] Length = 226 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 195 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 226 >OMO55996.1 hypothetical protein CCACVL1_26827 [Corchorus capsularis] Length = 226 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIP NATLLYDI FVG+YSGNAK Sbjct: 195 PAGCFSGDCNIPANATLLYDINFVGIYSGNAK 226 >EEF33399.1 fk506-binding protein, putative [Ricinus communis] Length = 148 Score = 65.9 bits (159), Expect = 2e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDI F+G+YSGN K Sbjct: 117 PAGCFSGDCNIPGNATLVYDINFLGIYSGNRK 148 >XP_015890886.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Ziziphus jujuba] Length = 224 Score = 67.0 bits (162), Expect = 3e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDI FVG+YSGN K Sbjct: 193 PAGCFSGDCNIPGNATLVYDINFVGIYSGNRK 224 >XP_002306326.1 immunophilin family protein [Populus trichocarpa] EEE93322.1 immunophilin family protein [Populus trichocarpa] Length = 185 Score = 66.2 bits (160), Expect = 3e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGN 474 PAGCFSGDCNIPGNATLLYDI FVG+YSGN Sbjct: 150 PAGCFSGDCNIPGNATLLYDINFVGVYSGN 179 >XP_006363941.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Solanum tuberosum] XP_015159182.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Solanum tuberosum] Length = 209 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDIKFV LYSGN K Sbjct: 177 PAGCFSGDCNIPGNATLVYDIKFVELYSGNRK 208 >XP_004237421.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Solanum lycopersicum] XP_015073922.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Solanum pennellii] Length = 209 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDIKFV LYSGN K Sbjct: 177 PAGCFSGDCNIPGNATLVYDIKFVELYSGNRK 208 >XP_008440633.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Cucumis melo] XP_008440634.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Cucumis melo] XP_008440635.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic [Cucumis melo] Length = 210 Score = 66.6 bits (161), Expect = 3e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDI FVG+YSGN K Sbjct: 179 PAGCFSGDCNIPGNATLVYDINFVGVYSGNRK 210 >XP_011657986.1 PREDICTED: photosynthetic NDH subunit of lumenal location 4, chloroplastic isoform X2 [Cucumis sativus] Length = 215 Score = 66.6 bits (161), Expect = 3e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 563 PAGCFSGDCNIPGNATLLYDIKFVGLYSGNAK 468 PAGCFSGDCNIPGNATL+YDI FVG+YSGN K Sbjct: 184 PAGCFSGDCNIPGNATLVYDINFVGVYSGNRK 215