BLASTX nr result
ID: Glycyrrhiza36_contig00002987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00002987 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003552419.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 94 1e-20 XP_003538459.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 94 1e-20 XP_017417357.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 88 2e-18 XP_014496398.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 87 5e-18 XP_007163532.1 hypothetical protein PHAVU_001G242100g [Phaseolus... 87 7e-18 XP_019439395.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 85 4e-17 XP_016181313.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 84 1e-16 XP_015944355.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 84 1e-16 NP_001189719.1 light harvesting complex photosystem II [Arabidop... 80 3e-16 KRX11507.1 Chlorophyll a-b binding protein CP29.3, chloroplastic... 77 5e-16 XP_019433570.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 81 7e-16 XP_006411258.1 hypothetical protein EUTSA_v10017060mg [Eutrema s... 81 1e-15 XP_010508915.1 PREDICTED: chlorophyll a-b binding protein CP29.3... 81 1e-15 JAU93328.1 Chlorophyll a-b binding protein CP29.3, chloroplastic... 80 1e-15 JAU05054.1 Chlorophyll a-b binding protein CP29.3, chloroplastic... 80 1e-15 AAM65936.1 putative chlorophyll a/b binding protein [Arabidopsis... 80 1e-15 XP_006294771.1 hypothetical protein CARUB_v10023823mg [Capsella ... 80 1e-15 NP_181539.1 light harvesting complex photosystem II [Arabidopsis... 80 1e-15 XP_002879843.1 LHCB4.3 [Arabidopsis lyrata subsp. lyrata] EFH561... 80 1e-15 KFK36898.1 hypothetical protein AALP_AA4G187000 [Arabis alpina] 80 1e-15 >XP_003552419.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like [Glycine max] KRG97750.1 hypothetical protein GLYMA_18G028400 [Glycine max] KRG97751.1 hypothetical protein GLYMA_18G028400 [Glycine max] Length = 278 Score = 94.0 bits (232), Expect = 1e-20 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 139 PPQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP KKK+V+VKP GDRLVWFP A+PPEWLDG+MIGDRGFDPFGFAK Sbjct: 42 PPPKKKEVKVKPSGDRLVWFPNAEPPEWLDGSMIGDRGFDPFGFAK 87 >XP_003538459.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like [Glycine max] KRH31130.1 hypothetical protein GLYMA_11G228800 [Glycine max] Length = 282 Score = 94.0 bits (232), Expect = 1e-20 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 139 PPQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP KKK+V+VKP GDRLVWFP A+PPEWLDG+MIGDRGFDPFGFAK Sbjct: 46 PPPKKKEVKVKPSGDRLVWFPNAEPPEWLDGSMIGDRGFDPFGFAK 91 >XP_017417357.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic [Vigna angularis] KOM39578.1 hypothetical protein LR48_Vigan03g296000 [Vigna angularis] BAT86418.1 hypothetical protein VIGAN_04406700 [Vigna angularis var. angularis] Length = 278 Score = 88.2 bits (217), Expect = 2e-18 Identities = 38/47 (80%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = -3 Query: 139 PPQKKKDVRVKPD-GDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP KKK+V+VKP GDRLVWFP A+PPEWLDG+MIGDRGFDPFGF+K Sbjct: 41 PPPKKKEVKVKPSSGDRLVWFPNAEPPEWLDGSMIGDRGFDPFGFSK 87 >XP_014496398.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic [Vigna radiata var. radiata] Length = 278 Score = 87.0 bits (214), Expect = 5e-18 Identities = 37/47 (78%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = -3 Query: 139 PPQKKKDVRVKPD-GDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP KKK+V+VKP GDRLVWFP A+PPEWLDG++IGDRGFDPFGF+K Sbjct: 41 PPPKKKEVKVKPSSGDRLVWFPNAEPPEWLDGSLIGDRGFDPFGFSK 87 >XP_007163532.1 hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris] ESW35526.1 hypothetical protein PHAVU_001G242100g [Phaseolus vulgaris] Length = 277 Score = 86.7 bits (213), Expect = 7e-18 Identities = 38/47 (80%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = -3 Query: 139 PPQKKKDVRVKP-DGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP KKK+V+VKP GDRLVWFP A PPEWLDG+MIGDRGFDPFGFA+ Sbjct: 40 PPPKKKEVKVKPVSGDRLVWFPKADPPEWLDGSMIGDRGFDPFGFAR 86 >XP_019439395.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like [Lupinus angustifolius] OIW14221.1 hypothetical protein TanjilG_21361 [Lupinus angustifolius] Length = 280 Score = 84.7 bits (208), Expect = 4e-17 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 139 PPQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KKK+V+VKP DRLVWFPGAQ PEWLDG+++GDRGFDP GFAK Sbjct: 44 PAPKKKEVKVKPGSDRLVWFPGAQSPEWLDGSLVGDRGFDPLGFAK 89 >XP_016181313.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic [Arachis ipaensis] Length = 285 Score = 83.6 bits (205), Expect = 1e-16 Identities = 40/53 (75%), Positives = 42/53 (79%), Gaps = 7/53 (13%) Frame = -3 Query: 139 PPQKKKDVR-----VKP--DGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PPQKKK+ KP GDRLVWFPGAQPPEWLDG+MIGDRGFDPFGFAK Sbjct: 42 PPQKKKEPAKPAKAAKPFSSGDRLVWFPGAQPPEWLDGSMIGDRGFDPFGFAK 94 >XP_015944355.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like [Arachis duranensis] Length = 285 Score = 83.6 bits (205), Expect = 1e-16 Identities = 40/53 (75%), Positives = 42/53 (79%), Gaps = 7/53 (13%) Frame = -3 Query: 139 PPQKKKDVR-----VKP--DGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PPQKKK+ KP GDRLVWFPGAQPPEWLDG+MIGDRGFDPFGFAK Sbjct: 42 PPQKKKEPAKPAKAAKPFSSGDRLVWFPGAQPPEWLDGSMIGDRGFDPFGFAK 94 >NP_001189719.1 light harvesting complex photosystem II [Arabidopsis thaliana] AEC09779.1 light harvesting complex photosystem II [Arabidopsis thaliana] Length = 185 Score = 80.5 bits (197), Expect = 3e-16 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >KRX11507.1 Chlorophyll a-b binding protein CP29.3, chloroplastic, partial [Trichinella nelsoni] Length = 84 Score = 77.0 bits (188), Expect = 5e-16 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = -3 Query: 139 PPQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 PP K KPD DRLVWFPGAQPPEWLDG+ +GDRGFDP G K Sbjct: 38 PPPPSKKAPKKPDTDRLVWFPGAQPPEWLDGSYVGDRGFDPLGLGK 83 >XP_019433570.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic-like isoform X1 [Lupinus angustifolius] OIV89675.1 hypothetical protein TanjilG_07751 [Lupinus angustifolius] Length = 279 Score = 81.3 bits (199), Expect = 7e-16 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 139 PPQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KKK+V+VKP DRLVW PGAQ PEWLDG+++GDRGFDP GF K Sbjct: 43 PSPKKKEVKVKPSSDRLVWLPGAQAPEWLDGSLVGDRGFDPLGFGK 88 >XP_006411258.1 hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum] BAJ33709.1 unnamed protein product [Eutrema halophilum] ESQ52711.1 hypothetical protein EUTSA_v10017060mg [Eutrema salsugineum] Length = 276 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA+PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGAKPPEWLDGSMIGDRGFDPFGLGK 86 >XP_010508915.1 PREDICTED: chlorophyll a-b binding protein CP29.3, chloroplastic [Camelina sativa] Length = 303 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 69 PPPKKSKQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 113 >JAU93328.1 Chlorophyll a-b binding protein CP29.3, chloroplastic [Noccaea caerulescens] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >JAU05054.1 Chlorophyll a-b binding protein CP29.3, chloroplastic [Noccaea caerulescens] JAU39300.1 Chlorophyll a-b binding protein CP29.3, chloroplastic [Noccaea caerulescens] JAU59694.1 Chlorophyll a-b binding protein CP29.3, chloroplastic [Noccaea caerulescens] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >AAM65936.1 putative chlorophyll a/b binding protein [Arabidopsis thaliana] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >XP_006294771.1 hypothetical protein CARUB_v10023823mg [Capsella rubella] EOA27669.1 hypothetical protein CARUB_v10023823mg [Capsella rubella] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSKQVQNDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >NP_181539.1 light harvesting complex photosystem II [Arabidopsis thaliana] Q9S7W1.1 RecName: Full=Chlorophyll a-b binding protein CP29.3, chloroplastic; AltName: Full=LHCB4.3; AltName: Full=LHCII protein 4.3; Flags: Precursor AAD28775.1 Lhcb4:3 protein [Arabidopsis thaliana] AAL49888.1 putative chlorophyll a/b binding protein [Arabidopsis thaliana] AAM20369.1 putative chlorophyll a/b binding protein [Arabidopsis thaliana] AEC09778.1 light harvesting complex photosystem II [Arabidopsis thaliana] OAP08841.1 LHCB4.3 [Arabidopsis thaliana] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >XP_002879843.1 LHCB4.3 [Arabidopsis lyrata subsp. lyrata] EFH56102.1 LHCB4.3 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 86 >KFK36898.1 hypothetical protein AALP_AA4G187000 [Arabis alpina] Length = 277 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 PQKKKDVRVKPDGDRLVWFPGAQPPEWLDGTMIGDRGFDPFGFAK 2 P KK +V+ DGDRLVWFPGA PPEWLDG+MIGDRGFDPFG K Sbjct: 43 PPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGK 87