BLASTX nr result
ID: Glycyrrhiza36_contig00002736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00002736 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004497514.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplas... 64 4e-10 GAU48474.1 hypothetical protein TSUD_405670 [Trifolium subterran... 64 8e-10 KHN48247.1 Ribonucleoprotein, chloroplastic [Glycine soja] 57 1e-07 NP_001240946.1 uncharacterized protein LOC100812934 [Glycine max... 57 1e-07 XP_003535181.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplas... 57 2e-07 KYP41912.1 hypothetical protein KK1_036683 [Cajanus cajan] 52 9e-06 >XP_004497514.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Cicer arietinum] Length = 284 Score = 64.3 bits (155), Expect = 4e-10 Identities = 33/43 (76%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALPTLRTRKPLCSSPQCLSSR--FSLNPNFKPFSI 305 MS++AASLALPTLRT++PLC SPQC SS FS+NPNFKPFSI Sbjct: 1 MSSSAASLALPTLRTKQPLC-SPQCFSSHPSFSINPNFKPFSI 42 >GAU48474.1 hypothetical protein TSUD_405670 [Trifolium subterraneum] Length = 278 Score = 63.5 bits (153), Expect = 8e-10 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALPTLRTRKPLCSSPQCLSS--RFSLNPNFKPFSI 305 MST+A SLALP+L T+ PLCSSPQC SS SLNPNFKPFSI Sbjct: 1 MSTSATSLALPSLFTKNPLCSSPQCFSSLPSLSLNPNFKPFSI 43 >KHN48247.1 Ribonucleoprotein, chloroplastic [Glycine soja] Length = 279 Score = 57.4 bits (137), Expect = 1e-07 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALPTL--RTRKPLCSSPQCLSSRFSLNPNFKPFSI 305 MST+AASLALPTL RTR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNSKPISI 42 >NP_001240946.1 uncharacterized protein LOC100812934 [Glycine max] ACU20155.1 unknown [Glycine max] KRH19946.1 hypothetical protein GLYMA_13G145200 [Glycine max] Length = 279 Score = 57.4 bits (137), Expect = 1e-07 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALPTL--RTRKPLCSSPQCLSSRFSLNPNFKPFSI 305 MST+AASLALPTL RTR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNSKPISI 42 >XP_003535181.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Glycine max] KRH32548.1 hypothetical protein GLYMA_10G058500 [Glycine max] Length = 275 Score = 57.0 bits (136), Expect = 2e-07 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALPTL--RTRKPLCSSPQCLSSRFSLNPNFKPFSI 305 MST+AASLALPTL RTR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNNKPISI 42 >KYP41912.1 hypothetical protein KK1_036683 [Cajanus cajan] Length = 279 Score = 52.4 bits (124), Expect = 9e-06 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 183 MSTTAASLALP--TLRTRKPLCSSPQCLSSRFSLNPNFKPFSI 305 MST+AASLALP TLRTR+PLC SPQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLC-SPQCFSS-LSLAPNSKPISI 41