BLASTX nr result
ID: Glycyrrhiza36_contig00002157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00002157 (752 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572586.1 PREDICTED: UBP1-associated protein 2C-like isofor... 71 2e-10 >XP_012572586.1 PREDICTED: UBP1-associated protein 2C-like isoform X2 [Cicer arietinum] Length = 415 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = -3 Query: 732 CFVQLCDGFLGANALNGCADFVHADNEIFGFGFMDXXXXXXXXXXXXXXLWFH 574 CF+QLCDGFLGA+ALNGCADFV ADNEI GF +MD LWFH Sbjct: 358 CFIQLCDGFLGASALNGCADFVLADNEICGFRYMDCCNLLLLHYLCFYVLWFH 410