BLASTX nr result
ID: Glycyrrhiza36_contig00002095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00002095 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016184266.1 PREDICTED: glycine-rich RNA-binding protein 4, mi... 66 3e-12 XP_015950872.1 PREDICTED: glycine-rich RNA-binding protein 4, mi... 66 3e-12 XP_019449963.1 PREDICTED: glycine-rich RNA-binding protein 4, mi... 59 2e-09 XP_019413203.1 PREDICTED: glycine-rich RNA-binding protein 4, mi... 58 6e-09 GAU19162.1 hypothetical protein TSUD_89270 [Trifolium subterraneum] 52 8e-07 XP_003540046.1 PREDICTED: glycine-rich RNA-binding protein 4, mi... 50 6e-06 >XP_016184266.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like [Arachis ipaensis] XP_016184267.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like [Arachis ipaensis] Length = 146 Score = 66.2 bits (160), Expect = 3e-12 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 78 GFRRLLCTNTSSPSATFPFVPTPSSGAPPARQMAEPSTNLF 200 G RRL CTNT+ PS +FPF+P P +GA PAR MAEP+TNLF Sbjct: 13 GLRRLFCTNTTKPSLSFPFIPPPQAGAQPARPMAEPNTNLF 53 >XP_015950872.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like [Arachis duranensis] Length = 146 Score = 66.2 bits (160), Expect = 3e-12 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 78 GFRRLLCTNTSSPSATFPFVPTPSSGAPPARQMAEPSTNLF 200 G RRL CTNT+ PS +FPF+P P +GA PAR MAEP+TNLF Sbjct: 13 GLRRLFCTNTTKPSLSFPFIPPPQAGAQPARPMAEPNTNLF 53 >XP_019449963.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like [Lupinus angustifolius] OIW08292.1 hypothetical protein TanjilG_02968 [Lupinus angustifolius] Length = 145 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 78 GFRRLLCTNTSSPSATFPFVPTPSSGAPPARQMAEPSTNLF 200 GFRR CTN S S+TFPFVP P++GA ARQMA+P+TNLF Sbjct: 13 GFRRFFCTNPPS-SSTFPFVPPPAAGATSARQMADPNTNLF 52 >XP_019413203.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial [Lupinus angustifolius] XP_019413204.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial [Lupinus angustifolius] OIV99139.1 hypothetical protein TanjilG_01114 [Lupinus angustifolius] Length = 145 Score = 57.8 bits (138), Expect = 6e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 78 GFRRLLCTNTSSPSATFPFVPTPSSGAPPARQMAEPSTNLF 200 G RR CTN +S S+TFPFVP P++GA ARQMA+P+TNLF Sbjct: 13 GLRRFFCTNPTS-SSTFPFVPPPAAGATSARQMADPNTNLF 52 >GAU19162.1 hypothetical protein TSUD_89270 [Trifolium subterraneum] Length = 146 Score = 52.4 bits (124), Expect = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 84 RRLLCTNTSSPSATFPFVPTPSSGAPPARQMAEPSTNLF 200 RRL CTN ++ S TFPF TP SG ARQMA+PSTNLF Sbjct: 19 RRLFCTNPTASSPTFPFTSTPPSG---ARQMADPSTNLF 54 >XP_003540046.1 PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like [Glycine max] KHN38590.1 Nucleolin [Glycine soja] KRH25927.1 hypothetical protein GLYMA_12G139200 [Glycine max] Length = 145 Score = 50.1 bits (118), Expect = 6e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 2/42 (4%) Frame = +3 Query: 81 FRRLLCTNTSSPSATFPFVPTPSSGA--PPARQMAEPSTNLF 200 FRR CTN++SPS FPFVPTP GA P R AEP+ NLF Sbjct: 13 FRRFFCTNSASPS--FPFVPTPPPGATPTPTRPTAEPNPNLF 52