BLASTX nr result
ID: Glycyrrhiza36_contig00001584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00001584 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EZY42791.1 hypothetical protein V052_02628, partial [Staphylococ... 81 3e-18 EUT77524.1 hypothetical protein O310_02010, partial [Staphylococ... 75 7e-16 KAE34487.1 hypothetical protein W610_02615, partial [Staphylococ... 73 3e-15 ADI17229.1 hypothetical protein, partial [uncultured alpha prote... 71 1e-13 WP_026390740.1 hypothetical protein [Acholeplasma axanthum] 63 4e-11 OGY07486.1 hypothetical protein A2694_04450 [Candidatus Blackbur... 64 5e-11 EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter j... 62 6e-11 KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulga... 61 3e-10 CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] 58 2e-09 EES70918.1 hypothetical protein POTG_04459 [Paenibacillus sp. or... 57 3e-09 OGM78425.1 hypothetical protein A2197_02960 [Candidatus Woesebac... 56 1e-08 OGM73289.1 hypothetical protein A2185_01740 [Candidatus Woesebac... 56 2e-08 ABR26094.1 retrotransposon protein [Oryza sativa Indica Group] 57 2e-08 CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella as... 55 3e-08 AID23550.1 hypothetical protein, partial [Phaeodactylum tricornu... 55 3e-08 KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] 59 5e-08 EFD76993.1 LOW QUALITY PROTEIN: predicted protein, partial [Myco... 55 5e-08 ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanic... 55 5e-08 AAF11800.1 hypothetical protein DR_2252 [Deinococcus radiodurans... 55 1e-07 AAF09840.1 hypothetical protein DR_0254 [Deinococcus radiodurans... 55 1e-07 >EZY42791.1 hypothetical protein V052_02628, partial [Staphylococcus aureus MSSA-93] EZY42792.1 hypothetical protein V052_02627, partial [Staphylococcus aureus MSSA-93] Length = 74 Score = 80.9 bits (198), Expect = 3e-18 Identities = 40/67 (59%), Positives = 46/67 (68%) Frame = +1 Query: 82 ANLLVVYATPHPFPLSHDLGALAVGLGCFPFHDGR*HPPCVSRAVLVGIRSLVRFGTAVG 261 AN+LVV+ATPHPFPL+ G LA GLGCFPF G HP S+ L+GIRSL FG G Sbjct: 1 ANILVVWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRG 60 Query: 262 GPSPSSA 282 P P+SA Sbjct: 61 APRPNSA 67 >EUT77524.1 hypothetical protein O310_02010, partial [Staphylococcus aureus M0125] EVA80172.1 hypothetical protein O597_00904, partial [Staphylococcus aureus M0549] Length = 70 Score = 74.7 bits (182), Expect = 7e-16 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = +1 Query: 94 VVYATPHPFPLSHDLGALAVGLGCFPFHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSP 273 VV+ATPHPFPL+ G LA GLGCFPF G HP S+ L+GIRSL FG G P P Sbjct: 1 VVWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRP 60 Query: 274 SSA 282 +SA Sbjct: 61 NSA 63 >KAE34487.1 hypothetical protein W610_02615, partial [Staphylococcus aureus VET0363R] KAE36074.1 hypothetical protein W610_02168, partial [Staphylococcus aureus VET0363R] KAE39600.1 hypothetical protein W610_00790, partial [Staphylococcus aureus VET0363R] Length = 69 Score = 73.2 bits (178), Expect = 3e-15 Identities = 36/62 (58%), Positives = 41/62 (66%) Frame = +1 Query: 97 VYATPHPFPLSHDLGALAVGLGCFPFHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSPS 276 V+ATPHPFPL+ G LA GLGCFPF G HP S+ L+GIRSL FG G P P+ Sbjct: 1 VWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRPN 60 Query: 277 SA 282 SA Sbjct: 61 SA 62 >ADI17229.1 hypothetical protein, partial [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 70.9 bits (172), Expect = 1e-13 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = +3 Query: 3 PVTSSAQEPLFRPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 P TSSAQ L RPVSYYAFFKGWLLLSQPPGCL TSFPT Sbjct: 99 PDTSSAQAGLSRPVSYYAFFKGWLLLSQPPGCLGLPTSFPT 139 >WP_026390740.1 hypothetical protein [Acholeplasma axanthum] Length = 74 Score = 62.8 bits (151), Expect = 4e-11 Identities = 34/71 (47%), Positives = 42/71 (59%) Frame = -2 Query: 265 GRPQRYQT*PNSEYLRVLLGRHTAGANVRREKGNNPDRQLRPLSRG*VGKDVELRRQPGG 86 G Y T N E + + T G V +KGN+PDRQLR + V K+VE+ +Q GG Sbjct: 4 GPTSGYWTQLNFECHKSEISSQTVGDKVHGQKGNSPDRQLRSQNSCWVEKEVEMHKQLGG 63 Query: 85 WLRSSHPLKKA 53 WLRSSHPLK A Sbjct: 64 WLRSSHPLKSA 74 >OGY07486.1 hypothetical protein A2694_04450 [Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_01_FULL_40_17] OGY08829.1 hypothetical protein A3D24_03150 [Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_02_FULL_39_13] Length = 109 Score = 63.5 bits (153), Expect = 5e-11 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = -1 Query: 173 KGKQPRPTAKAPKSWLSGKGCGVA*TTRRLA*KQPSFKESVIAHWS 36 KGKQPR + KA K WLS KG T RRLA KQPSFKESVIAHWS Sbjct: 3 KGKQPRLSVKASKFWLSCKGSYYPQTPRRLAQKQPSFKESVIAHWS 48 >EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter jejuni subsp. jejuni 1336] Length = 51 Score = 61.6 bits (148), Expect = 6e-11 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 RPVSYYAFFKGWLLLSQPPGCL N TSF T Sbjct: 22 RPVSYYAFFKGWLLLSQPPGCLSNFTSFST 51 >KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulgaris subsp. vulgaris] Length = 79 Score = 60.8 bits (146), Expect = 3e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFP 122 RPVSYYAFFKGWLLLSQPPGCL STSFP Sbjct: 51 RPVSYYAFFKGWLLLSQPPGCLCLSTSFP 79 >CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] Length = 51 Score = 57.8 bits (138), Expect = 2e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 RPVSYYA FK WLLLSQ PGCL NSTSFPT Sbjct: 22 RPVSYYALFKWWLLLSQHPGCLGNSTSFPT 51 >EES70918.1 hypothetical protein POTG_04459 [Paenibacillus sp. oral taxon 786 str. D14] Length = 44 Score = 57.4 bits (137), Expect = 3e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 RPVSYYA FK WLLLSQ PGCL NSTSFPT Sbjct: 15 RPVSYYALFKWWLLLSQHPGCLCNSTSFPT 44 >OGM78425.1 hypothetical protein A2197_02960 [Candidatus Woesebacteria bacterium RIFOXYA1_FULL_48_16] OGM83412.1 hypothetical protein A2376_02965 [Candidatus Woesebacteria bacterium RIFOXYB1_FULL_47_31] Length = 73 Score = 56.2 bits (134), Expect = 1e-08 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -1 Query: 173 KGKQPRPTAKAPKSWLSGKGCGVA*TTRRLA*KQPSFKESVIAHWS 36 +GK PR +AKA KS LS KG T RRLA KQP FKESV AHWS Sbjct: 3 RGKHPRLSAKASKSILSLKGSSFPKTARRLAQKQPPFKESVTAHWS 48 >OGM73289.1 hypothetical protein A2185_01740 [Candidatus Woesebacteria bacterium RIFOXYA1_FULL_31_71] OGM82246.1 hypothetical protein A2422_00205 [Candidatus Woesebacteria bacterium RIFOXYC1_FULL_31_51] Length = 61 Score = 55.8 bits (133), Expect = 2e-08 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -1 Query: 173 KGKQPRPTAKAPKSWLSGKGCGVA*TTRRLA*KQPSFKESVIAHWS 36 KGK PR +AKA KS LS KG + T RRLA KQP FK+SV AHWS Sbjct: 3 KGKHPRFSAKASKSTLSLKGSFFSQTARRLAQKQPPFKDSVTAHWS 48 >ABR26094.1 retrotransposon protein [Oryza sativa Indica Group] Length = 109 Score = 56.6 bits (135), Expect = 2e-08 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 199 TAGANVRREKGNNPDRQLRPLSRG*VGKDVELRRQPGGWLRSSHPLKKA 53 T G + R +GN+PD QLRPL+ V K+V ++RQPGG RSSHPLK A Sbjct: 61 TMGDKLHRREGNSPDHQLRPLNDRSVIKEVGVQRQPGGLPRSSHPLKSA 109 >CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella asinigenitalis 14/45] Length = 53 Score = 55.1 bits (131), Expect = 3e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 R VSYYAFFKGWLLLSQPP CL TSFPT Sbjct: 24 RSVSYYAFFKGWLLLSQPPDCLCLPTSFPT 53 >AID23550.1 hypothetical protein, partial [Phaeodactylum tricornutum] Length = 73 Score = 55.5 bits (132), Expect = 3e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 R VSYYAFFKGWLLLSQPP CL TSFPT Sbjct: 44 RLVSYYAFFKGWLLLSQPPSCLSLPTSFPT 73 >KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] Length = 345 Score = 58.5 bits (140), Expect = 5e-08 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT*PRLRGLSC 152 R VSYYAFF+GWLLL +PPGCL TSF T RGLSC Sbjct: 249 RSVSYYAFFQGWLLLGKPPGCLCTPTSFITERSFRGLSC 287 >EFD76993.1 LOW QUALITY PROTEIN: predicted protein, partial [Mycobacterium tuberculosis T85] Length = 68 Score = 54.7 bits (130), Expect = 5e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 38 TSELLRFL*RMAASKPTSWLSTQLHILSHLATT*GP 145 TSELLR L R+AASKPTSWLS +LHILSHLA GP Sbjct: 33 TSELLRTLSRVAASKPTSWLSLRLHILSHLAHAWGP 68 >ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1] Length = 98 Score = 55.5 bits (132), Expect = 5e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT 125 R VSYYAFFKGWLLLSQPP CL TSFPT Sbjct: 69 RLVSYYAFFKGWLLLSQPPSCLSLPTSFPT 98 >AAF11800.1 hypothetical protein DR_2252 [Deinococcus radiodurans R1] Length = 133 Score = 55.5 bits (132), Expect = 1e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT*PRLRGLS 149 RPVSYYA F+GWLLLSQPPGCL + TS T R LS Sbjct: 96 RPVSYYALFEGWLLLSQPPGCLCDDTSLTTERSFRDLS 133 >AAF09840.1 hypothetical protein DR_0254 [Deinococcus radiodurans R1] Length = 139 Score = 55.5 bits (132), Expect = 1e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +3 Query: 36 RPVSYYAFFKGWLLLSQPPGCLRNSTSFPT*PRLRGLS 149 RPVSYYA F+GWLLLSQPPGCL + TS T R LS Sbjct: 102 RPVSYYALFEGWLLLSQPPGCLCDDTSLTTERSFRDLS 139