BLASTX nr result
ID: Glycyrrhiza36_contig00001506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00001506 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU19853.1 unknown [Glycine max] 53 2e-07 GAU18043.1 hypothetical protein TSUD_51540 [Trifolium subterraneum] 54 9e-07 KYP69196.1 hypothetical protein KK1_008384 [Cajanus cajan] 53 1e-06 KHN37388.1 hypothetical protein glysoja_013603 [Glycine soja] 53 1e-06 KHN11499.1 hypothetical protein glysoja_015394 [Glycine soja] 53 1e-06 XP_004497195.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 54 2e-06 XP_014514768.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 53 2e-06 XP_017415758.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 53 2e-06 XP_003555859.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 53 2e-06 XP_003536721.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 53 2e-06 XP_007142803.1 hypothetical protein PHAVU_007G018100g [Phaseolus... 53 2e-06 KRG90659.1 hypothetical protein GLYMA_20G106600 [Glycine max] 53 2e-06 OIV91271.1 hypothetical protein TanjilG_30493 [Lupinus angustifo... 52 4e-06 XP_016176845.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 52 4e-06 XP_015942146.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 52 4e-06 XP_019453248.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1... 52 6e-06 XP_010086829.1 hypothetical protein L484_006058 [Morus notabilis... 52 6e-06 >ACU19853.1 unknown [Glycine max] Length = 94 Score = 53.1 bits (126), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 68 FLGIHSPAAVVSEIIIISQFLVSLYLR 94 >GAU18043.1 hypothetical protein TSUD_51540 [Trifolium subterraneum] Length = 313 Score = 54.3 bits (129), Expect = 9e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR*KGK 144 FLGIHSPAAVVSEVII SQFLVSLYLR GK Sbjct: 266 FLGIHSPAAVVSEVIIFSQFLVSLYLRLTGK 296 >KYP69196.1 hypothetical protein KK1_008384 [Cajanus cajan] Length = 214 Score = 53.1 bits (126), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 188 FLGIHSPAAVVSEIIIISQFLVSLYLR 214 >KHN37388.1 hypothetical protein glysoja_013603 [Glycine soja] Length = 214 Score = 53.1 bits (126), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 188 FLGIHSPAAVVSEIIIISQFLVSLYLR 214 >KHN11499.1 hypothetical protein glysoja_015394 [Glycine soja] Length = 214 Score = 53.1 bits (126), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 188 FLGIHSPAAVVSEIIIISQFLVSLYLR 214 >XP_004497195.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Cicer arietinum] Length = 287 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSEVIIISQFLVSLYLR Sbjct: 261 FLGIHSPAAVVSEVIIISQFLVSLYLR 287 >XP_014514768.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Vigna radiata var. radiata] Length = 280 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 254 FLGIHSPAAVVSEIIIISQFLVSLYLR 280 >XP_017415758.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Vigna angularis] KOM36407.1 hypothetical protein LR48_Vigan02g255700 [Vigna angularis] BAT93679.1 hypothetical protein VIGAN_08020300 [Vigna angularis var. angularis] Length = 280 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 254 FLGIHSPAAVVSEIIIISQFLVSLYLR 280 >XP_003555859.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic-like [Glycine max] KRG90660.1 hypothetical protein GLYMA_20G106600 [Glycine max] Length = 280 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 254 FLGIHSPAAVVSEIIIISQFLVSLYLR 280 >XP_003536721.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic-like [Glycine max] KRH36091.1 hypothetical protein GLYMA_10G283100 [Glycine max] Length = 280 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 254 FLGIHSPAAVVSEIIIISQFLVSLYLR 280 >XP_007142803.1 hypothetical protein PHAVU_007G018100g [Phaseolus vulgaris] ESW14797.1 hypothetical protein PHAVU_007G018100g [Phaseolus vulgaris] Length = 281 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 255 FLGIHSPAAVVSEIIIISQFLVSLYLR 281 >KRG90659.1 hypothetical protein GLYMA_20G106600 [Glycine max] Length = 310 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLGIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 284 FLGIHSPAAVVSEIIIISQFLVSLYLR 310 >OIV91271.1 hypothetical protein TanjilG_30493 [Lupinus angustifolius] Length = 260 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 F+GIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 234 FMGIHSPAAVVSEIIIISQFLVSLYLR 260 >XP_016176845.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Arachis ipaensis] Length = 296 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 F+GIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 270 FMGIHSPAAVVSEIIIISQFLVSLYLR 296 >XP_015942146.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Arachis duranensis] Length = 296 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 F+GIHSPAAVVSE+IIISQFLVSLYLR Sbjct: 270 FMGIHSPAAVVSEIIIISQFLVSLYLR 296 >XP_019453248.1 PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Lupinus angustifolius] OIW06796.1 hypothetical protein TanjilG_11521 [Lupinus angustifolius] Length = 289 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 F+G+HSPAAVVSE+IIISQFLVSLYLR Sbjct: 263 FMGVHSPAAVVSEIIIISQFLVSLYLR 289 >XP_010086829.1 hypothetical protein L484_006058 [Morus notabilis] EXB24027.1 hypothetical protein L484_006058 [Morus notabilis] Length = 292 Score = 52.0 bits (123), Expect = 6e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 236 FLGIHSPAAVVSEVIIISQFLVSLYLR 156 FLG+HSPAAVVSEVI+ISQFLVSLYLR Sbjct: 266 FLGLHSPAAVVSEVILISQFLVSLYLR 292