BLASTX nr result
ID: Glycyrrhiza36_contig00000289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00000289 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017408321.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IV... 69 9e-13 KHM99387.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Glycine s... 67 2e-12 NP_001237767.1 Bowman-Birk type protease inhibitor-like precurso... 67 2e-12 NP_001236539.1 uncharacterized protein LOC100305522 precursor [G... 67 2e-12 AAA19574.1 Bowman-Birk protease inhibitor, partial [Glycine max] 63 2e-11 AAA19613.1 Bowman-Birk protease inhibitor, partial [Glycine max] 63 2e-11 CAC24564.1 trypsin inhibitor [Pisum sativum] 64 4e-11 KOM27952.1 hypothetical protein LR48_Vigan470s000500 [Vigna angu... 67 4e-11 XP_003623930.2 Bowman birk trypsin inhibitor [Medicago truncatul... 64 4e-11 1BBI_A Chain A, Three-Dimensional Structure Of Soybean Trypsin(S... 63 5e-11 CAA29122.1 unnamed protein product [synthetic construct] 63 5e-11 XP_014497359.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IV... 64 8e-11 XP_003623933.1 Bowman birk trypsin inhibitor [Medicago truncatul... 62 1e-10 P85172.1 RecName: Full=Bowman-Birk type proteinase inhibitor; Sh... 62 1e-10 P83284.1 RecName: Full=Bowman-birk type proteinase inhibitor; Al... 62 1e-10 AFK47823.1 unknown [Medicago truncatula] 63 1e-10 NP_001238547.1 Bowman-Birk type proteinase inhibitor precursor [... 63 1e-10 AAO89510.1 Bowman-Birk protease inhibitor [Glycine microphylla] 63 1e-10 KRH38803.1 hypothetical protein GLYMA_09G158900 [Glycine max] 63 1e-10 KYP64426.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Cajanus c... 63 1e-10 >XP_017408321.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IVA-like [Vigna angularis] BAT83642.1 hypothetical protein VIGAN_04082600 [Vigna angularis var. angularis] Length = 121 Score = 68.6 bits (166), Expect = 9e-13 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEKLTKNDQ 176 HSACKSC C +S+PP+CRC DITDFCY PC+S E KL N Q Sbjct: 79 HSACKSCVCTKSIPPQCRCEDITDFCYKPCHSEE-PKLAGNSQ 120 >KHM99387.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Glycine soja] Length = 113 Score = 67.4 bits (163), Expect = 2e-12 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAE 197 HSACK+C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 76 HSACKTCICTRSIPPQCHCSDITNFCYEPCNSSETE 111 >NP_001237767.1 Bowman-Birk type protease inhibitor-like precursor [Glycine max] ACA23206.1 putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 67.4 bits (163), Expect = 2e-12 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAE 197 HSACK+C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 80 HSACKTCICTRSIPPQCHCSDITNFCYEPCNSSETE 115 >NP_001236539.1 uncharacterized protein LOC100305522 precursor [Glycine max] ACU13240.1 unknown [Glycine max] KRH00722.1 hypothetical protein GLYMA_18G231500 [Glycine max] Length = 117 Score = 67.4 bits (163), Expect = 2e-12 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAE 197 HSACK+C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 80 HSACKTCICTRSIPPQCHCSDITNFCYEPCNSSETE 115 >AAA19574.1 Bowman-Birk protease inhibitor, partial [Glycine max] Length = 41 Score = 62.8 bits (151), Expect = 2e-11 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 2 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 38 >AAA19613.1 Bowman-Birk protease inhibitor, partial [Glycine max] Length = 42 Score = 62.8 bits (151), Expect = 2e-11 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 4 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 40 >CAC24564.1 trypsin inhibitor [Pisum sativum] Length = 104 Score = 63.9 bits (154), Expect = 4e-11 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCN 212 HSACK+C C SLPP+CRC+DITDFCY+ CN Sbjct: 74 HSACKTCICTRSLPPQCRCIDITDFCYEKCN 104 >KOM27952.1 hypothetical protein LR48_Vigan470s000500 [Vigna angularis] Length = 236 Score = 66.6 bits (161), Expect = 4e-11 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSE 203 HSACKSC C +S+PP+CRC DITDFCY PC+S E Sbjct: 79 HSACKSCVCTKSIPPQCRCEDITDFCYKPCHSEE 112 >XP_003623930.2 Bowman birk trypsin inhibitor [Medicago truncatula] AES80148.2 Bowman birk trypsin inhibitor [Medicago truncatula] Length = 107 Score = 63.9 bits (154), Expect = 4e-11 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAE 197 HSACK+C C ES P KC C+DITDFCY+PCNS+ A+ Sbjct: 70 HSACKTCRCFESFPLKCDCLDITDFCYEPCNSTIAK 105 >1BBI_A Chain A, Three-Dimensional Structure Of Soybean Trypsin(Slash)chymotrypsin Bowman-Birk Inhibitor In Solution 2BBI_A Chain A, Three-dimensional Structure Of Soybean Trypsin(slash)chymotrypsin Bowman-birk Inhibitor In Solution Length = 71 Score = 62.8 bits (151), Expect = 5e-11 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 33 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 69 >CAA29122.1 unnamed protein product [synthetic construct] Length = 72 Score = 62.8 bits (151), Expect = 5e-11 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 34 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 70 >XP_014497359.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IVA-like [Vigna radiata var. radiata] Length = 121 Score = 63.5 bits (153), Expect = 8e-11 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEKLTKNDQ 176 HSACKSC C S+PP+C C DIT+FCY PC+S E K T N Q Sbjct: 79 HSACKSCFCTRSIPPQCHCQDITNFCYKPCHSDE-PKFTGNGQ 120 >XP_003623933.1 Bowman birk trypsin inhibitor [Medicago truncatula] AES80151.1 Bowman birk trypsin inhibitor [Medicago truncatula] Length = 86 Score = 62.4 bits (150), Expect = 1e-10 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSS 206 HS CKSC C ESLP KC C+DIT+FCY+PCN+S Sbjct: 49 HSDCKSCRCFESLPLKCTCLDITEFCYEPCNNS 81 >P85172.1 RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 61.6 bits (148), Expect = 1e-10 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSS 206 HSACKSC C S PP+CRC DIT FCY PC SS Sbjct: 31 HSACKSCICTRSFPPQCRCSDITHFCYKPCTSS 63 >P83284.1 RecName: Full=Bowman-birk type proteinase inhibitor; AltName: Full=TaTI Length = 63 Score = 61.6 bits (148), Expect = 1e-10 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCN 212 HSAC+SCAC S+P KCRC DITDFCY PC+ Sbjct: 32 HSACESCACTRSIPAKCRCFDITDFCYKPCS 62 >AFK47823.1 unknown [Medicago truncatula] Length = 107 Score = 62.8 bits (151), Expect = 1e-10 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAE 197 HSACK+C C ES P KC C DITDFCY+PCNS+ A+ Sbjct: 70 HSACKTCRCFESFPLKCDCPDITDFCYEPCNSTIAK 105 >NP_001238547.1 Bowman-Birk type proteinase inhibitor precursor [Glycine max] P01055.2 RecName: Full=Bowman-Birk type proteinase inhibitor; Short=BBI; Flags: Precursor CAA48655.1 Soybean Bowman-Birk proteinase inhibitor [Glycine max] AAO89509.1 Bowman-Birk protease inhibitor [Glycine max] prf||2013215C Bowman-Birk protease inhibitor Length = 110 Score = 62.8 bits (151), Expect = 1e-10 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 72 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 108 >AAO89510.1 Bowman-Birk protease inhibitor [Glycine microphylla] Length = 111 Score = 62.8 bits (151), Expect = 1e-10 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 73 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 109 >KRH38803.1 hypothetical protein GLYMA_09G158900 [Glycine max] Length = 112 Score = 62.8 bits (151), Expect = 1e-10 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNSSEAEK 194 HSACKSC C S P +C CVDITDFCY+PC SE +K Sbjct: 73 HSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDK 109 >KYP64426.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Cajanus cajan] Length = 113 Score = 62.8 bits (151), Expect = 1e-10 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 304 HSACKSCACGESLPPKCRCVDITDFCYDPCNS 209 HSACK+C C S+PP+CRC DITDFCY+PC + Sbjct: 75 HSACKTCFCTRSIPPQCRCADITDFCYEPCTN 106