BLASTX nr result
ID: Glycyrrhiza35_contig00040636
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00040636 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013457307.1 ethylene-responsive nuclear-like protein, putativ... 60 3e-08 KHN14311.1 hypothetical protein glysoja_012349 [Glycine soja] 53 1e-05 >XP_013457307.1 ethylene-responsive nuclear-like protein, putative [Medicago truncatula] KEH31338.1 ethylene-responsive nuclear-like protein, putative [Medicago truncatula] Length = 343 Score = 60.5 bits (145), Expect = 3e-08 Identities = 34/70 (48%), Positives = 40/70 (57%) Frame = -2 Query: 306 QDLTMNSEDRRINRVGNSGYMXXXXXXXXXXXXGRFPALILTMTWCFMLKIVTSRGRSLA 127 +D+ + SE + RVGNS YM GRFPAL+L MTWC M+KI RGRS Sbjct: 277 EDMRVTSE---VKRVGNSDYMILFGIALVGLVLGRFPALVLAMTWCLMVKIGAVRGRSKK 333 Query: 126 PLIKCSVPKS 97 LIK VP S Sbjct: 334 SLIKSYVPSS 343 >KHN14311.1 hypothetical protein glysoja_012349 [Glycine soja] Length = 210 Score = 52.8 bits (125), Expect = 1e-05 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 3/83 (3%) Frame = -2 Query: 336 NEVDHAVTVSQDLTMNSEDRRINRVGNSG--YMXXXXXXXXXXXXGRFPALILTMTWCFM 163 +++D +T S D ++R+ RVGNSG + GRFPAL+L MTWC + Sbjct: 133 SKLDCGITCSYD-----NEKRVERVGNSGSSMVLVMIIALVGLLLGRFPALVLLMTWCCL 187 Query: 162 LKIVTSRGRSL-APLIKCSVPKS 97 +KIV RS P+IKCSV S Sbjct: 188 MKIVGILWRSQNVPMIKCSVSNS 210