BLASTX nr result
ID: Glycyrrhiza35_contig00040294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00040294 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004488392.1 PREDICTED: uncharacterized protein LOC101495171 i... 67 2e-11 XP_004488393.1 PREDICTED: uncharacterized protein LOC101495171 i... 65 8e-11 XP_003595667.2 hypothetical protein MTR_2g058870 [Medicago trunc... 60 6e-09 GAU23272.1 hypothetical protein TSUD_281670 [Trifolium subterran... 55 3e-07 KYP42708.1 hypothetical protein KK1_035897 [Cajanus cajan] 54 5e-07 XP_007138224.1 hypothetical protein PHAVU_009G190900g [Phaseolus... 52 4e-06 >XP_004488392.1 PREDICTED: uncharacterized protein LOC101495171 isoform X1 [Cicer arietinum] Length = 175 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 266 RMEPPHHMFLGGASEECHSSESGWTMYIGSPI 171 RMEPPHHM LGGA EECHSSESGWTMYIGSPI Sbjct: 6 RMEPPHHMLLGGA-EECHSSESGWTMYIGSPI 36 >XP_004488393.1 PREDICTED: uncharacterized protein LOC101495171 isoform X2 [Cicer arietinum] XP_012575217.1 PREDICTED: uncharacterized protein LOC101495171 isoform X2 [Cicer arietinum] Length = 169 Score = 64.7 bits (156), Expect = 8e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 263 MEPPHHMFLGGASEECHSSESGWTMYIGSPI 171 MEPPHHM LGGA EECHSSESGWTMYIGSPI Sbjct: 1 MEPPHHMLLGGA-EECHSSESGWTMYIGSPI 30 >XP_003595667.2 hypothetical protein MTR_2g058870 [Medicago truncatula] AES65918.2 hypothetical protein MTR_2g058870 [Medicago truncatula] Length = 161 Score = 59.7 bits (143), Expect = 6e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 263 MEPPHHMFLGGASEECHSSESGWTMYIGSPI 171 MEPPHH+FL + EECHSSESGWTMYIGSPI Sbjct: 1 MEPPHHIFLA-SEEECHSSESGWTMYIGSPI 30 >GAU23272.1 hypothetical protein TSUD_281670 [Trifolium subterraneum] Length = 161 Score = 55.1 bits (131), Expect = 3e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 263 MEPPHHMFLGGASEECHSSESGWTMYIGSPI 171 ME P HM LG A EECHSSESGWTMYIGSPI Sbjct: 1 MEQPLHMLLG-AEEECHSSESGWTMYIGSPI 30 >KYP42708.1 hypothetical protein KK1_035897 [Cajanus cajan] Length = 148 Score = 54.3 bits (129), Expect = 5e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 263 MEPPHHMFLGGASEECHSSESGWTMYIGSP 174 MEPPH M LG + EECHS+ESGWTMYIGSP Sbjct: 1 MEPPHVM-LGSSEEECHSNESGWTMYIGSP 29 >XP_007138224.1 hypothetical protein PHAVU_009G190900g [Phaseolus vulgaris] ESW10218.1 hypothetical protein PHAVU_009G190900g [Phaseolus vulgaris] Length = 141 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 263 MEPPHHMFLGGASEECHSSESGWTMYIGSP 174 MEPPH M G EECHS+ESGWTMYIGSP Sbjct: 1 MEPPHVML--GGEEECHSNESGWTMYIGSP 28