BLASTX nr result
ID: Glycyrrhiza35_contig00040199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00040199 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN47353.1 Auxin response factor 6 [Glycine soja] 67 1e-10 KHN06947.1 Auxin response factor 6 [Glycine soja] 65 5e-10 XP_015579070.1 PREDICTED: auxin response factor 8 isoform X1 [Ri... 64 2e-09 KYP45168.1 Auxin response factor 6 [Cajanus cajan] 61 1e-08 OIV95744.1 hypothetical protein TanjilG_05292 [Lupinus angustifo... 61 1e-08 OIW14034.1 hypothetical protein TanjilG_11379 [Lupinus angustifo... 61 1e-08 KCW89825.1 hypothetical protein EUGRSUZ_A020651, partial [Eucaly... 59 5e-08 KCW89823.1 hypothetical protein EUGRSUZ_A020651, partial [Eucaly... 59 5e-08 KCW89824.1 hypothetical protein EUGRSUZ_A020651, partial [Eucaly... 59 5e-08 XP_008381532.1 PREDICTED: auxin response factor 8-like [Malus do... 59 6e-08 KRH58710.1 hypothetical protein GLYMA_05G1438001, partial [Glyci... 59 6e-08 KRH58711.1 hypothetical protein GLYMA_05G1438001, partial [Glyci... 59 6e-08 BAB85914.1 auxin response factor 6a, partial [Oryza sativa] 59 6e-08 ONM12279.1 Auxin response factor 3 [Zea mays] 59 6e-08 XP_008648947.1 PREDICTED: auxin response factor 17-like isoform ... 59 6e-08 AQK47168.1 Auxin response factor 8 [Zea mays] 59 6e-08 ONM12268.1 Auxin response factor 3 [Zea mays] 59 6e-08 EEF29407.1 Auxin response factor, putative [Ricinus communis] 59 6e-08 EPS62844.1 auxin response factor 8-1, partial [Genlisea aurea] 59 6e-08 CBI27334.3 unnamed protein product, partial [Vitis vinifera] 59 6e-08 >KHN47353.1 Auxin response factor 6 [Glycine soja] Length = 900 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVILL 226 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVILL Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVILL 220 >KHN06947.1 Auxin response factor 6 [Glycine soja] Length = 902 Score = 65.1 bits (157), Expect = 5e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVILL 226 RHLLTTGWSVFVSAKRLVAGDSVLFIWQV LL Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVTLL 220 >XP_015579070.1 PREDICTED: auxin response factor 8 isoform X1 [Ricinus communis] Length = 852 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVILLF 223 RHLLTTGWSVFVSAKRLVAGDSVLFIW I LF Sbjct: 190 RHLLTTGWSVFVSAKRLVAGDSVLFIWYFIFLF 222 >KYP45168.1 Auxin response factor 6 [Cajanus cajan] Length = 792 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQ 238 RHLLTTGWSVFVSAKRLVAGDSVLFIWQ Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIWQ 216 >OIV95744.1 hypothetical protein TanjilG_05292 [Lupinus angustifolius] Length = 916 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVI 232 RHLLTTGWSVFVSAKRLVAGD+VLFIWQ I Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDAVLFIWQCI 218 >OIW14034.1 hypothetical protein TanjilG_11379 [Lupinus angustifolius] Length = 919 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIWQVI 232 RHLLTTGWSVFVSAKRLVAGD+VLFIWQ I Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDAVLFIWQCI 218 >KCW89825.1 hypothetical protein EUGRSUZ_A020651, partial [Eucalyptus grandis] Length = 310 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIW 215 >KCW89823.1 hypothetical protein EUGRSUZ_A020651, partial [Eucalyptus grandis] Length = 313 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 194 RHLLTTGWSVFVSAKRLVAGDSVLFIW 220 >KCW89824.1 hypothetical protein EUGRSUZ_A020651, partial [Eucalyptus grandis] Length = 315 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 194 RHLLTTGWSVFVSAKRLVAGDSVLFIW 220 >XP_008381532.1 PREDICTED: auxin response factor 8-like [Malus domestica] Length = 352 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 193 RHLLTTGWSVFVSAKRLVAGDSVLFIW 219 >KRH58710.1 hypothetical protein GLYMA_05G1438001, partial [Glycine max] Length = 392 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIW 215 >KRH58711.1 hypothetical protein GLYMA_05G1438001, partial [Glycine max] Length = 393 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIW 215 >BAB85914.1 auxin response factor 6a, partial [Oryza sativa] Length = 396 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 175 RHLLTTGWSVFVSAKRLVAGDSVLFIW 201 >ONM12279.1 Auxin response factor 3 [Zea mays] Length = 409 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 195 RHLLTTGWSVFVSAKRLVAGDSVLFIW 221 >XP_008648947.1 PREDICTED: auxin response factor 17-like isoform X3 [Zea mays] Length = 412 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 210 RHLLTTGWSVFVSAKRLVAGDSVLFIW 236 >AQK47168.1 Auxin response factor 8 [Zea mays] Length = 419 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 190 RHLLTTGWSVFVSAKRLVAGDSVLFIW 216 >ONM12268.1 Auxin response factor 3 [Zea mays] Length = 437 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 195 RHLLTTGWSVFVSAKRLVAGDSVLFIW 221 >EEF29407.1 Auxin response factor, putative [Ricinus communis] Length = 478 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 189 RHLLTTGWSVFVSAKRLVAGDSVLFIW 215 >EPS62844.1 auxin response factor 8-1, partial [Genlisea aurea] Length = 480 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 196 RHLLTTGWSVFVSAKRLVAGDSVLFIW 222 >CBI27334.3 unnamed protein product, partial [Vitis vinifera] Length = 486 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 321 RHLLTTGWSVFVSAKRLVAGDSVLFIW 241 RHLLTTGWSVFVSAKRLVAGDSVLFIW Sbjct: 191 RHLLTTGWSVFVSAKRLVAGDSVLFIW 217