BLASTX nr result
ID: Glycyrrhiza35_contig00039626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039626 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU14562.1 hypothetical protein TSUD_96260 [Trifolium subterraneum] 59 2e-08 >GAU14562.1 hypothetical protein TSUD_96260 [Trifolium subterraneum] Length = 145 Score = 58.9 bits (141), Expect = 2e-08 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = +1 Query: 151 TETYKEKLLNIFGEVV---PKKYDFKNLAQPSSAVASGEGSGT-GLVIPLSDEEWQRWSQ 318 T +YKEKLLN+FGE V P+ D +++ + + V S GL IPL D EW +WSQ Sbjct: 10 TMSYKEKLLNLFGEEVKSHPRNKDHESMNEMNVEVESETRPYVDGLDIPLQDTEWDQWSQ 69 Query: 319 LWQRCLITKVLGK 357 W++ LI ++GK Sbjct: 70 SWKKTLIVTLMGK 82