BLASTX nr result
ID: Glycyrrhiza35_contig00039586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039586 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHG30905.1 putative WD-repeat protein [Narcissus tazetta] 55 4e-07 AHG30904.1 putative WD-repeat protein [Narcissus tazetta] 55 4e-07 KRH18656.1 hypothetical protein GLYMA_13G074400 [Glycine max] 53 6e-07 KQK91609.1 hypothetical protein SETIT_037992mg [Setaria italica] 52 8e-07 KHN43687.1 Putative WD repeat-containing protein C2A9.03 [Glycin... 51 2e-06 CBI41088.3 unnamed protein product, partial [Vitis vinifera] 53 2e-06 XP_003635411.2 PREDICTED: uncharacterized WD repeat-containing p... 53 2e-06 XP_004984950.1 PREDICTED: uncharacterized WD repeat-containing p... 52 4e-06 XP_004984949.1 PREDICTED: uncharacterized WD repeat-containing p... 52 4e-06 XP_012698410.1 PREDICTED: uncharacterized WD repeat-containing p... 52 4e-06 AQK54840.1 WD repeat-containing protein-like protein [Zea mays] ... 51 4e-06 AQK54841.1 WD repeat-containing protein-like protein [Zea mays] ... 51 5e-06 XP_020195055.1 uncharacterized WD repeat-containing protein C2A9... 52 7e-06 OEL29611.1 putative WD repeat-containing protein C2A9.03 [Dichan... 52 7e-06 XP_006346240.1 PREDICTED: uncharacterized WD repeat-containing p... 52 7e-06 XP_020195054.1 uncharacterized WD repeat-containing protein C2A9... 52 7e-06 XP_020195052.1 uncharacterized WD repeat-containing protein C2A9... 52 7e-06 EMT06758.1 Putative WD repeat-containing protein [Aegilops tausc... 52 7e-06 AQK54839.1 WD repeat-containing protein-like protein [Zea mays] ... 51 7e-06 AQL03298.1 Transducin/WD40 repeat-like superfamily protein [Zea ... 50 8e-06 >AHG30905.1 putative WD-repeat protein [Narcissus tazetta] Length = 433 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S WH D N+FA GN D TCR+WD RN SES+ VFR Sbjct: 311 SAWHPDGNVFATGNQDKTCRLWDVRNLSESLAVFR 345 >AHG30904.1 putative WD-repeat protein [Narcissus tazetta] Length = 433 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S WH D N+FA GN D TCR+WD RN SES+ VFR Sbjct: 311 SAWHPDGNVFATGNQDKTCRLWDVRNLSESLAVFR 345 >KRH18656.1 hypothetical protein GLYMA_13G074400 [Glycine max] Length = 152 Score = 53.1 bits (126), Expect = 6e-07 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -1 Query: 100 WHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 WHLD N+FA GN D TCRVWD RN S+S+ V + Sbjct: 63 WHLDGNIFATGNQDKTCRVWDVRNLSKSVAVLK 95 >KQK91609.1 hypothetical protein SETIT_037992mg [Setaria italica] Length = 133 Score = 52.4 bits (124), Expect = 8e-07 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W+ D FA GN D TCR+WDARN S+S+HV R Sbjct: 11 SAWNPDGRTFATGNQDKTCRIWDARNLSQSVHVLR 45 >KHN43687.1 Putative WD repeat-containing protein C2A9.03 [Glycine soja] Length = 121 Score = 51.2 bits (121), Expect = 2e-06 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 100 WHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 WHLD ++FA GN D TCRVWD RN S+S+ V + Sbjct: 32 WHLDGHIFATGNQDKTCRVWDVRNLSKSVAVLK 64 >CBI41088.3 unnamed protein product, partial [Vitis vinifera] Length = 323 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S WH D N+FA GN D TCR+WDARN S+S+ V + Sbjct: 201 SAWHPDGNIFATGNQDKTCRIWDARNLSKSVAVLK 235 >XP_003635411.2 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] XP_003635521.3 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] Length = 445 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S WH D N+FA GN D TCR+WDARN S+S+ V + Sbjct: 323 SAWHPDGNIFATGNQDKTCRIWDARNLSKSVAVLK 357 >XP_004984950.1 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X3 [Setaria italica] XP_004984951.1 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X3 [Setaria italica] Length = 455 Score = 52.4 bits (124), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W+ D FA GN D TCR+WDARN S+S+HV R Sbjct: 333 SAWNPDGRTFATGNQDKTCRIWDARNLSQSVHVLR 367 >XP_004984949.1 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Setaria italica] Length = 467 Score = 52.4 bits (124), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W+ D FA GN D TCR+WDARN S+S+HV R Sbjct: 345 SAWNPDGRTFATGNQDKTCRIWDARNLSQSVHVLR 379 >XP_012698410.1 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Setaria italica] Length = 468 Score = 52.4 bits (124), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W+ D FA GN D TCR+WDARN S+S+HV R Sbjct: 346 SAWNPDGRTFATGNQDKTCRIWDARNLSQSVHVLR 380 >AQK54840.1 WD repeat-containing protein-like protein [Zea mays] AQK54844.1 WD repeat-containing protein-like protein [Zea mays] AQK54845.1 WD repeat-containing protein-like protein [Zea mays] AQK54847.1 WD repeat-containing protein-like protein [Zea mays] AQK54851.1 WD repeat-containing protein-like protein [Zea mays] AQK54855.1 WD repeat-containing protein-like protein [Zea mays] AQK54858.1 WD repeat-containing protein-like protein [Zea mays] AQK54860.1 WD repeat-containing protein-like protein [Zea mays] AQK54862.1 WD repeat-containing protein-like protein [Zea mays] AQK54863.1 WD repeat-containing protein-like protein [Zea mays] AQK54877.1 WD repeat-containing protein-like protein [Zea mays] Length = 168 Score = 51.2 bits (121), Expect = 4e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCR+WDARN S+S+HV R Sbjct: 46 SAWSPDGRTFATGNQDKTCRIWDARNLSKSVHVLR 80 >AQK54841.1 WD repeat-containing protein-like protein [Zea mays] AQK54849.1 WD repeat-containing protein-like protein [Zea mays] AQK54865.1 WD repeat-containing protein-like protein [Zea mays] AQK54873.1 WD repeat-containing protein-like protein [Zea mays] Length = 183 Score = 51.2 bits (121), Expect = 5e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCR+WDARN S+S+HV R Sbjct: 61 SAWSPDGRTFATGNQDKTCRIWDARNLSKSVHVLR 95 >XP_020195055.1 uncharacterized WD repeat-containing protein C2A9.03-like isoform X3 [Aegilops tauschii subsp. tauschii] Length = 345 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCRVWDARN S+S+HV R Sbjct: 223 SAWSPDGRTFATGNQDRTCRVWDARNLSQSLHVLR 257 >OEL29611.1 putative WD repeat-containing protein C2A9.03 [Dichanthelium oligosanthes] Length = 381 Score = 51.6 bits (122), Expect = 7e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCR+WDARN S+S+HV R Sbjct: 259 SAWSPDGRTFATGNQDKTCRIWDARNLSQSVHVLR 293 >XP_006346240.1 PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Solanum tuberosum] Length = 419 Score = 51.6 bits (122), Expect = 7e-06 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S WH D FA GN+DGTCR+WD RN S+S+ V + Sbjct: 297 SAWHPDGQTFATGNEDGTCRIWDIRNLSKSVTVLK 331 >XP_020195054.1 uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Aegilops tauschii subsp. tauschii] Length = 436 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCRVWDARN S+S+HV R Sbjct: 314 SAWSPDGRTFATGNQDRTCRVWDARNLSQSLHVLR 348 >XP_020195052.1 uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Aegilops tauschii subsp. tauschii] XP_020195053.1 uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Aegilops tauschii subsp. tauschii] Length = 447 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCRVWDARN S+S+HV R Sbjct: 325 SAWSPDGRTFATGNQDRTCRVWDARNLSQSLHVLR 359 >EMT06758.1 Putative WD repeat-containing protein [Aegilops tauschii] Length = 517 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCRVWDARN S+S+HV R Sbjct: 395 SAWSPDGRTFATGNQDRTCRVWDARNLSQSLHVLR 429 >AQK54839.1 WD repeat-containing protein-like protein [Zea mays] AQK54846.1 WD repeat-containing protein-like protein [Zea mays] AQK54853.1 WD repeat-containing protein-like protein [Zea mays] AQK54854.1 WD repeat-containing protein-like protein [Zea mays] AQK54859.1 WD repeat-containing protein-like protein [Zea mays] AQK54867.1 WD repeat-containing protein-like protein [Zea mays] AQK54874.1 WD repeat-containing protein-like protein [Zea mays] Length = 234 Score = 51.2 bits (121), Expect = 7e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCR+WDARN S+S+HV R Sbjct: 112 SAWSPDGRTFATGNQDKTCRIWDARNLSKSVHVLR 146 >AQL03298.1 Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 171 Score = 50.4 bits (119), Expect = 8e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -1 Query: 106 STWHLDENLFAIGNDDGTCRVWDARNYSESIHVFR 2 S W D FA GN D TCR+WDARN +ES+HV R Sbjct: 49 SAWSPDGLTFATGNQDKTCRIWDARNLTESVHVLR 83