BLASTX nr result
ID: Glycyrrhiza35_contig00039552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039552 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-cont... 75 2e-13 XP_003630975.1 PPR containing plant-like protein [Medicago trunc... 68 5e-11 XP_019422754.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 >XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X1 [Cicer arietinum] XP_012572060.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X2 [Cicer arietinum] Length = 705 Score = 74.7 bits (182), Expect = 2e-13 Identities = 44/93 (47%), Positives = 48/93 (51%), Gaps = 2/93 (2%) Frame = -1 Query: 278 TEQVITRILRNPNRRVS--TRQAKQLHGHVVRTKGTSHPDNXXXXXXXXXXXXXXXXXXX 105 TE +IT ILRNP R VS TRQAKQLH H+V+TKGT H DN Sbjct: 5 TEHIITNILRNPKRTVSVSTRQAKQLHAHIVKTKGTFHDDNILVLSLYSNLNLLHHSLHL 64 Query: 104 XXXXXXXXXXXXXXXLIKCYTSHNLPHLSLSSF 6 LIKCYTSH+L HLS SSF Sbjct: 65 FNSLPSPPPPLAWSSLIKCYTSHSLLHLSFSSF 97 >XP_003630975.1 PPR containing plant-like protein [Medicago truncatula] AET05451.1 PPR containing plant-like protein [Medicago truncatula] Length = 701 Score = 68.2 bits (165), Expect = 5e-11 Identities = 41/95 (43%), Positives = 49/95 (51%), Gaps = 3/95 (3%) Frame = -1 Query: 278 TEQVITRILRN-PNRR--VSTRQAKQLHGHVVRTKGTSHPDNXXXXXXXXXXXXXXXXXX 108 T+ I++ILR PN+ VSTRQAKQLH H+V+TKGT H DN Sbjct: 5 TQHTISKILRKTPNKTLSVSTRQAKQLHAHIVKTKGTLHSDNILVLSLYSNLNLLQHSLH 64 Query: 107 XXXXXXXXXXXXXXXXLIKCYTSHNLPHLSLSSFN 3 +IKCYTSH+L HLS SSFN Sbjct: 65 LFNSLPSPPPPLAWSSIIKCYTSHSLLHLSFSSFN 99 >XP_019422754.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Lupinus angustifolius] Length = 722 Score = 58.2 bits (139), Expect = 2e-07 Identities = 33/92 (35%), Positives = 44/92 (47%) Frame = -1 Query: 278 TEQVITRILRNPNRRVSTRQAKQLHGHVVRTKGTSHPDNXXXXXXXXXXXXXXXXXXXXX 99 T+ +I I++NPN +ST AKQLH H+++TKGT HP + Sbjct: 6 TQNLIKTIIKNPNPTISTFHAKQLHAHILKTKGTFHP-HHSSILSLYSSLKLLHDSLLLF 64 Query: 98 XXXXXXXXXXXXXLIKCYTSHNLPHLSLSSFN 3 +IKCY SH L H SL+SFN Sbjct: 65 NTLHSPPPLAWISIIKCYISHGLLHSSLASFN 96