BLASTX nr result
ID: Glycyrrhiza35_contig00039412
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039412 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM51319.1 hypothetical protein LR48_Vigan08g214600 [Vigna angul... 97 2e-21 BAT91377.1 hypothetical protein VIGAN_06269900 [Vigna angularis ... 97 2e-21 XP_017432968.1 PREDICTED: TATA-binding protein-associated factor... 97 2e-21 XP_014493829.1 PREDICTED: TATA-binding protein-associated factor... 97 2e-21 XP_007131306.1 hypothetical protein PHAVU_011G002900g [Phaseolus... 97 2e-21 GAU37973.1 hypothetical protein TSUD_269880, partial [Trifolium ... 89 5e-21 XP_008219029.1 PREDICTED: TATA-binding protein-associated factor... 96 7e-21 KHN11636.1 TATA-binding protein-associated factor 172 [Glycine s... 96 9e-21 XP_006587727.1 PREDICTED: TATA-binding protein-associated factor... 96 9e-21 XP_003540105.1 PREDICTED: TATA-binding protein-associated factor... 96 9e-21 XP_008374031.2 PREDICTED: TATA-binding protein-associated factor... 93 1e-20 XP_011461625.1 PREDICTED: TATA-binding protein-associated factor... 95 2e-20 OAY44504.1 hypothetical protein MANES_08G155800 [Manihot esculenta] 94 2e-20 EEF38332.1 TATA-binding protein-associated factor MOT1, putative... 94 2e-20 XP_015577732.1 PREDICTED: LOW QUALITY PROTEIN: TATA-binding prot... 94 2e-20 XP_012070332.1 PREDICTED: TATA-binding protein-associated factor... 94 2e-20 XP_012070331.1 PREDICTED: TATA-binding protein-associated factor... 94 2e-20 ONH98925.1 hypothetical protein PRUPE_6G000100 [Prunus persica] 94 2e-20 XP_002275285.1 PREDICTED: TATA-binding protein-associated factor... 94 2e-20 XP_010661187.1 PREDICTED: TATA-binding protein-associated factor... 94 2e-20 >KOM51319.1 hypothetical protein LR48_Vigan08g214600 [Vigna angularis] Length = 1443 Score = 97.4 bits (241), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >BAT91377.1 hypothetical protein VIGAN_06269900 [Vigna angularis var. angularis] Length = 1776 Score = 97.4 bits (241), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >XP_017432968.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Vigna angularis] Length = 2037 Score = 97.4 bits (241), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >XP_014493829.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Vigna radiata var. radiata] XP_014493830.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Vigna radiata var. radiata] XP_014493831.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Vigna radiata var. radiata] XP_014493832.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Vigna radiata var. radiata] Length = 2038 Score = 97.4 bits (241), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >XP_007131306.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] XP_007131307.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] XP_007131308.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] ESW03300.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] ESW03301.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] ESW03302.1 hypothetical protein PHAVU_011G002900g [Phaseolus vulgaris] Length = 2046 Score = 97.4 bits (241), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >GAU37973.1 hypothetical protein TSUD_269880, partial [Trifolium subterraneum] Length = 107 Score = 89.4 bits (220), Expect = 5e-21 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -1 Query: 139 GSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 GSTQATRLTAARQIG+IAKSHPQDLTSLLKKVSQYLRSK WDTRVA Sbjct: 1 GSTQATRLTAARQIGEIAKSHPQDLTSLLKKVSQYLRSKKWDTRVA 46 >XP_008219029.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Prunus mume] Length = 2051 Score = 95.9 bits (237), Expect = 7e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 63 >KHN11636.1 TATA-binding protein-associated factor 172 [Glycine soja] Length = 2033 Score = 95.5 bits (236), Expect = 9e-21 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYL SKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLHSKNWDTRVA 63 >XP_006587727.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587729.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587730.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587731.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587732.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587733.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_006587734.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_014617842.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] XP_014617843.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Glycine max] KRH40036.1 hypothetical protein GLYMA_09G234400 [Glycine max] KRH40037.1 hypothetical protein GLYMA_09G234400 [Glycine max] KRH40038.1 hypothetical protein GLYMA_09G234400 [Glycine max] KRH40039.1 hypothetical protein GLYMA_09G234400 [Glycine max] Length = 2047 Score = 95.5 bits (236), Expect = 9e-21 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYL SKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLHSKNWDTRVA 63 >XP_003540105.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like isoform X1 [Glycine max] XP_006591944.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like isoform X1 [Glycine max] XP_006591945.1 PREDICTED: TATA-binding protein-associated factor BTAF1-like isoform X1 [Glycine max] KHN32463.1 TATA-binding protein-associated factor 172 [Glycine soja] KRH23759.1 hypothetical protein GLYMA_12G002300 [Glycine max] KRH23760.1 hypothetical protein GLYMA_12G002300 [Glycine max] KRH23761.1 hypothetical protein GLYMA_12G002300 [Glycine max] Length = 2047 Score = 95.5 bits (236), Expect = 9e-21 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGS QATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSNQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >XP_008374031.2 PREDICTED: TATA-binding protein-associated factor BTAF1-like [Malus domestica] Length = 316 Score = 93.2 bits (230), Expect = 1e-20 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAK+HPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRFTAARQIGDIAKAHPQDLSSLLKKVSQYLRSKNWDTRVA 63 >XP_011461625.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Fragaria vesca subsp. vesca] XP_011461626.1 PREDICTED: TATA-binding protein-associated factor BTAF1 [Fragaria vesca subsp. vesca] Length = 2043 Score = 94.7 bits (234), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDLTSLLKKVSQYLRS+NWDTRVA Sbjct: 17 DTGSTQATRFTAARQIGDIAKSHPQDLTSLLKKVSQYLRSRNWDTRVA 64 >OAY44504.1 hypothetical protein MANES_08G155800 [Manihot esculenta] Length = 1903 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 17 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 64 >EEF38332.1 TATA-binding protein-associated factor MOT1, putative [Ricinus communis] Length = 1920 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 63 >XP_015577732.1 PREDICTED: LOW QUALITY PROTEIN: TATA-binding protein-associated factor BTAF1 [Ricinus communis] Length = 1980 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 63 >XP_012070332.1 PREDICTED: TATA-binding protein-associated factor BTAF1 isoform X2 [Jatropha curcas] Length = 2037 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 17 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 64 >XP_012070331.1 PREDICTED: TATA-binding protein-associated factor BTAF1 isoform X1 [Jatropha curcas] Length = 2038 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 17 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 64 >ONH98925.1 hypothetical protein PRUPE_6G000100 [Prunus persica] Length = 2051 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATR TAARQIGDIAKSHPQDL+SLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRFTAARQIGDIAKSHPQDLSSLLKKVSQYLRSKNWDTRVA 63 >XP_002275285.1 PREDICTED: TATA-binding protein-associated factor BTAF1 isoform X2 [Vitis vinifera] Length = 2052 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDL SLL+KVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLNSLLRKVSQYLRSKNWDTRVA 63 >XP_010661187.1 PREDICTED: TATA-binding protein-associated factor BTAF1 isoform X1 [Vitis vinifera] XP_010661188.1 PREDICTED: TATA-binding protein-associated factor BTAF1 isoform X1 [Vitis vinifera] Length = 2054 Score = 94.4 bits (233), Expect = 2e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDL SLL+KVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLNSLLRKVSQYLRSKNWDTRVA 63