BLASTX nr result
ID: Glycyrrhiza35_contig00039289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039289 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN34334.1 hypothetical protein glysoja_016662 [Glycine soja] 58 2e-08 KYP70250.1 FAS-associated factor 2-B [Cajanus cajan] 56 2e-07 XP_016190945.1 PREDICTED: plant UBX domain-containing protein 10... 55 3e-07 XP_015967662.1 PREDICTED: plant UBX domain-containing protein 10... 55 6e-07 >KHN34334.1 hypothetical protein glysoja_016662 [Glycine soja] Length = 189 Score = 57.8 bits (138), Expect = 2e-08 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 5/40 (12%) Frame = -2 Query: 106 RDHSMVRRMASLPRSIMGGISRAMG-----VGIGRRRNQH 2 RDH +VRRMASLPRSIMGGISRAM +G GRRRNQH Sbjct: 6 RDHGIVRRMASLPRSIMGGISRAMEDGMGFIGRGRRRNQH 45 >KYP70250.1 FAS-associated factor 2-B [Cajanus cajan] Length = 381 Score = 56.2 bits (134), Expect = 2e-07 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = -2 Query: 106 RDHSMVRRMASLPRSIMGGISRAMG-----VGIGRRR 11 RDH +VRRMASLPRSIMGGISRAMG VGIGRRR Sbjct: 6 RDHRIVRRMASLPRSIMGGISRAMGDGMCLVGIGRRR 42 >XP_016190945.1 PREDICTED: plant UBX domain-containing protein 10-like [Arachis ipaensis] XP_016190956.1 PREDICTED: plant UBX domain-containing protein 10-like [Arachis ipaensis] Length = 395 Score = 55.5 bits (132), Expect = 3e-07 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 5/45 (11%) Frame = -2 Query: 121 SSAVRRDHSMVRRMASLPRSIMGGISRAMG-----VGIGRRRNQH 2 SS RDH +VRR+ASLPRSIMG ISRA+G VGIGRRRN + Sbjct: 2 SSPATRDHRIVRRVASLPRSIMGEISRALGDGMGLVGIGRRRNHN 46 >XP_015967662.1 PREDICTED: plant UBX domain-containing protein 10-like [Arachis duranensis] Length = 393 Score = 54.7 bits (130), Expect = 6e-07 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 5/47 (10%) Frame = -2 Query: 127 MSSSAVRRDHSMVRRMASLPRSIMGGISRAMG-----VGIGRRRNQH 2 MSS A+R DH +VRR+ASLPRSIMG ISRAM VGIGRRRN + Sbjct: 1 MSSPAIR-DHRIVRRVASLPRSIMGEISRAMADGMGLVGIGRRRNHN 46