BLASTX nr result
ID: Glycyrrhiza35_contig00039162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00039162 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013461328.1 hypothetical protein MTR_3g088705 [Medicago trunc... 58 4e-09 OIV96769.1 hypothetical protein TanjilG_19928 [Lupinus angustifo... 51 2e-06 >XP_013461328.1 hypothetical protein MTR_3g088705 [Medicago truncatula] KEH35363.1 hypothetical protein MTR_3g088705 [Medicago truncatula] Length = 67 Score = 57.8 bits (138), Expect = 4e-09 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 9/55 (16%) Frame = +1 Query: 1 HKPKNGSVFPAKRCSVKQMMWNRVVE---------SVTPPPKLSQCNKSNSVVHP 138 HKPKNGSVFPAK+ SVK+MMW++ V+ +V+PPP Q +++NS VHP Sbjct: 14 HKPKNGSVFPAKKRSVKKMMWDQFVDPKGNNSSSNTVSPPP--PQSSRANSTVHP 66 >OIV96769.1 hypothetical protein TanjilG_19928 [Lupinus angustifolius] Length = 75 Score = 51.2 bits (121), Expect = 2e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 5/59 (8%) Frame = +1 Query: 1 HKPK-NGSVFPAKRCSVKQMMWNRVVESVTPPPKLSQCNKSNS---VVHP-FSTEPLVD 162 HKPK NGSV P KR SVKQM+W RVV+ K ++ K N+ VVHP FS+E +D Sbjct: 17 HKPKKNGSVIPPKRRSVKQMIWERVVDPSIAANKGTKKKKKNNNYVVVHPTFSSESFID 75