BLASTX nr result
ID: Glycyrrhiza35_contig00038666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00038666 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW07285.1 hypothetical protein TanjilG_11919 [Lupinus angustifo... 53 4e-06 >OIW07285.1 hypothetical protein TanjilG_11919 [Lupinus angustifolius] Length = 297 Score = 52.8 bits (125), Expect = 4e-06 Identities = 33/68 (48%), Positives = 40/68 (58%), Gaps = 7/68 (10%) Frame = +3 Query: 48 MADRIHMSLDDIIKRSS-----ANLPPRRHSVHGP--DRRFSLRSPVRTTPYSIPQARQQ 206 MA I MSLDDIIKRS+ A+ R HGP DRRF +R +TTPY IPQ R Sbjct: 1 MAASIDMSLDDIIKRSTTATATASRRRSRDRPHGPGPDRRFEVRKQAKTTPYFIPQERAL 60 Query: 207 VWRRSIFP 230 + R+ + P Sbjct: 61 LSRKVLQP 68