BLASTX nr result
ID: Glycyrrhiza35_contig00038547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00038547 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN24329.1 Putative RNA methyltransferase pc1998 [Glycine soja] 57 1e-07 >KHN24329.1 Putative RNA methyltransferase pc1998 [Glycine soja] Length = 217 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 15/54 (27%) Frame = +2 Query: 158 DPHFFKSTAPAANVRTSLPPLPIWGWRCHAKL---------------EGTHNVI 274 D + F ST P AN+RTSL LP+WGWRC AKL EGTHNV+ Sbjct: 30 DANLFNSTVPTANLRTSLSSLPVWGWRCRAKLAVRGSSTEPLIGLYEEGTHNVV 83