BLASTX nr result
ID: Glycyrrhiza35_contig00038484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00038484 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003547194.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 4e-06 GAU23466.1 hypothetical protein TSUD_331640 [Trifolium subterran... 52 5e-06 >XP_003547194.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] KHN06945.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH11127.1 hypothetical protein GLYMA_15G090700 [Glycine max] Length = 793 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 111 MAILRLNHYLLEKVLASHFCANHLSSIAFSLYSARN 218 M +LR NHYLL K+LASHF AN+ SS+A SL+SA N Sbjct: 1 MPLLRFNHYLLGKILASHFHANYFSSVALSLFSATN 36 >GAU23466.1 hypothetical protein TSUD_331640 [Trifolium subterraneum] Length = 617 Score = 52.0 bits (123), Expect = 5e-06 Identities = 28/42 (66%), Positives = 30/42 (71%), Gaps = 6/42 (14%) Frame = +3 Query: 111 MAILRLNHYLLEKVLASHFCANHLSSIAFSL------YSARN 218 MAILRLNHYLL K LASHFC N+LS IA +L YSA N Sbjct: 1 MAILRLNHYLLGKTLASHFCVNNLSCIALNLCSVSGSYSATN 42