BLASTX nr result
ID: Glycyrrhiza35_contig00038270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00038270 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAS21009.1 ubiquitin-conjugating enzyme E2, partial [Hyacinthus ... 53 4e-07 XP_013464586.1 ubiquitin-conjugating enzyme [Medicago truncatula... 53 2e-06 OMO92459.1 Ubiquitin-conjugating enzyme, E2 [Corchorus olitorius] 50 2e-06 KCW67497.1 hypothetical protein EUGRSUZ_F012261, partial [Eucaly... 50 2e-06 ABA27026.1 TO71-1, partial [Taraxacum officinale] 50 3e-06 KJB61587.1 hypothetical protein B456_009G368300 [Gossypium raimo... 52 3e-06 XP_006442525.1 hypothetical protein CICLE_v10022662mg [Citrus cl... 50 4e-06 KVI02204.1 hypothetical protein Ccrd_019547 [Cynara cardunculus ... 51 4e-06 XP_012490852.1 PREDICTED: ubiquitin-conjugating enzyme E2 35-lik... 50 4e-06 XP_012472329.1 PREDICTED: ubiquitin-conjugating enzyme E2 35-lik... 50 5e-06 XP_013682959.1 PREDICTED: ubiquitin-conjugating enzyme E2 36-lik... 50 6e-06 XP_013464585.1 ubiquitin-conjugating enzyme [Medicago truncatula... 50 6e-06 NP_001031298.1 ubiquitin-conjugating enzyme 35 [Arabidopsis thal... 50 6e-06 XP_006442520.1 hypothetical protein CICLE_v10022662mg [Citrus cl... 50 6e-06 KCW69943.1 hypothetical protein EUGRSUZ_F03261 [Eucalyptus grandis] 50 7e-06 KDO44643.1 hypothetical protein CISIN_1g031783mg [Citrus sinensis] 50 7e-06 ONK79239.1 uncharacterized protein A4U43_C01F4340 [Asparagus off... 51 7e-06 OIW08218.1 hypothetical protein TanjilG_15179 [Lupinus angustifo... 51 7e-06 XP_012848631.1 PREDICTED: ubiquitin-conjugating enzyme E2 36 [Er... 51 7e-06 XP_013712557.1 PREDICTED: ubiquitin-conjugating enzyme E2 36-lik... 51 8e-06 >AAS21009.1 ubiquitin-conjugating enzyme E2, partial [Hyacinthus orientalis] Length = 82 Score = 52.8 bits (125), Expect = 4e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSM 107 ASPSE NMRYFNVMI GPTQSPY+ + E+ M Sbjct: 34 ASPSEENMRYFNVMILGPTQSPYEGSPEYEEM 65 >XP_013464586.1 ubiquitin-conjugating enzyme [Medicago truncatula] KEH38621.1 ubiquitin-conjugating enzyme [Medicago truncatula] Length = 167 Score = 52.8 bits (125), Expect = 2e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIM 113 ASPSE NMRYFNVMI GPTQSPY+ + + N++++ Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGSDDTNNLVL 60 >OMO92459.1 Ubiquitin-conjugating enzyme, E2 [Corchorus olitorius] Length = 69 Score = 50.4 bits (119), Expect = 2e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 13 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 47 >KCW67497.1 hypothetical protein EUGRSUZ_F012261, partial [Eucalyptus grandis] KCW67498.1 hypothetical protein EUGRSUZ_F012261, partial [Eucalyptus grandis] Length = 70 Score = 50.4 bits (119), Expect = 2e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >ABA27026.1 TO71-1, partial [Taraxacum officinale] Length = 75 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 20 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 54 >KJB61587.1 hypothetical protein B456_009G368300 [Gossypium raimondii] Length = 131 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGRGVFKLELFLP 62 >XP_006442525.1 hypothetical protein CICLE_v10022662mg [Citrus clementina] ESR55765.1 hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 88 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >KVI02204.1 hypothetical protein Ccrd_019547 [Cynara cardunculus var. scolymus] Length = 109 Score = 50.8 bits (120), Expect = 4e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEENMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >XP_012490852.1 PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Gossypium raimondii] Length = 93 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >XP_012472329.1 PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Gossypium raimondii] Length = 83 Score = 50.1 bits (118), Expect = 5e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLGLFLP 61 >XP_013682959.1 PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brassica napus] Length = 110 Score = 50.4 bits (119), Expect = 6e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVM+ GPTQSPY+ + F + LP Sbjct: 27 ASPSEENMRYFNVMVLGPTQSPYEGGV-FKLELFLP 61 >XP_013464585.1 ubiquitin-conjugating enzyme [Medicago truncatula] KEH38620.1 ubiquitin-conjugating enzyme [Medicago truncatula] Length = 111 Score = 50.4 bits (119), Expect = 6e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >NP_001031298.1 ubiquitin-conjugating enzyme 35 [Arabidopsis thaliana] AEE36166.1 ubiquitin-conjugating enzyme 35 [Arabidopsis thaliana] Length = 112 Score = 50.4 bits (119), Expect = 6e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >XP_006442520.1 hypothetical protein CICLE_v10022662mg [Citrus clementina] ESR55760.1 hypothetical protein CICLE_v10022662mg [Citrus clementina] KDO44644.1 hypothetical protein CISIN_1g031783mg [Citrus sinensis] Length = 113 Score = 50.4 bits (119), Expect = 6e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >KCW69943.1 hypothetical protein EUGRSUZ_F03261 [Eucalyptus grandis] Length = 118 Score = 50.4 bits (119), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >KDO44643.1 hypothetical protein CISIN_1g031783mg [Citrus sinensis] Length = 120 Score = 50.4 bits (119), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEDNMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >ONK79239.1 uncharacterized protein A4U43_C01F4340 [Asparagus officinalis] Length = 139 Score = 50.8 bits (120), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 13 ASPSEENMRYFNVMILGPTQSPYEGGV-FKLELFLP 47 >OIW08218.1 hypothetical protein TanjilG_15179 [Lupinus angustifolius] Length = 139 Score = 50.8 bits (120), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 27 ASPSEENMRYFNVMILGPTQSPYEGGV-FKLELFLP 61 >XP_012848631.1 PREDICTED: ubiquitin-conjugating enzyme E2 36 [Erythranthe guttata] Length = 142 Score = 50.8 bits (120), Expect = 7e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSN 89 ASPSE NMRYFNVMI GPTQSPY+ N Sbjct: 27 ASPSEENMRYFNVMILGPTQSPYEGN 52 >XP_013712557.1 PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brassica napus] Length = 146 Score = 50.8 bits (120), Expect = 8e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 12 ASPSEANMRYFNVMIFGPTQSPYDSNIEFNSMIMLP 119 ASPSE NMRYFNVMI GPTQSPY+ + F + LP Sbjct: 20 ASPSEENMRYFNVMILGPTQSPYEGGV-FKLELFLP 54