BLASTX nr result
ID: Glycyrrhiza35_contig00037229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00037229 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36990.1 hypothetical protein TSUD_150260 [Trifolium subterran... 54 1e-05 >GAU36990.1 hypothetical protein TSUD_150260 [Trifolium subterraneum] Length = 517 Score = 53.5 bits (127), Expect = 1e-05 Identities = 26/32 (81%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +1 Query: 274 LSIFHRRK-NLESFFKYLFSDRNPPLLPSLGV 366 LSIFHRR NLE+FFK+LFSD NPPL+PSLGV Sbjct: 78 LSIFHRRGLNLETFFKFLFSDSNPPLVPSLGV 109