BLASTX nr result
ID: Glycyrrhiza35_contig00036777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00036777 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003591134.1 SPFH/band 7/PHB domain membrane-associated family... 75 6e-14 AFK34752.1 unknown [Medicago truncatula] 69 1e-13 XP_003603336.2 SPFH/band 7/PHB domain membrane-associated family... 74 2e-13 XP_003603332.1 SPFH/band 7/PHB domain membrane-associated family... 74 2e-13 XP_003590560.1 SPFH/band 7/PHB domain membrane-associated family... 72 4e-13 XP_013470396.1 SPFH/band 7/PHB domain membrane-associated family... 72 4e-13 XP_013468625.1 SPFH/band 7/PHB domain membrane-associated family... 72 4e-13 XP_014632416.1 PREDICTED: flotillin-like protein 3 [Glycine max] 69 4e-13 XP_003603337.2 SPFH/band 7/PHB domain membrane-associated family... 72 5e-13 XP_007224585.1 hypothetical protein PRUPE_ppa1027148mg [Prunus p... 71 1e-12 XP_008219544.1 PREDICTED: flotillin-like protein 4 [Prunus mume] 71 1e-12 XP_017257372.1 PREDICTED: flotillin-like protein 3 [Daucus carot... 70 2e-12 XP_007222834.1 hypothetical protein PRUPE_ppa005113mg [Prunus pe... 70 3e-12 XP_017421294.1 PREDICTED: flotillin-like protein 4 [Vigna angula... 69 5e-12 OMP12228.1 hypothetical protein COLO4_03388, partial [Corchorus ... 67 6e-12 XP_013461876.1 SPFH/band 7/PHB domain membrane-associated family... 69 9e-12 XP_003603333.2 SPFH/band 7/PHB domain membrane-associated family... 69 9e-12 XP_009382095.1 PREDICTED: flotillin-like protein 1 [Musa acumina... 69 9e-12 XP_007226306.1 hypothetical protein PRUPE_ppa020951mg [Prunus pe... 68 1e-11 XP_009362350.2 PREDICTED: flotillin-like protein 4 [Pyrus x bret... 68 1e-11 >XP_003591134.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR2.1 RecName: Full=Flotillin-like protein 6 ADA83098.1 flotillin-like protein 6 [Medicago truncatula] AES61385.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 472 Score = 74.7 bits (182), Expect = 6e-14 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GG A GMKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 429 GGEAGGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 465 >AFK34752.1 unknown [Medicago truncatula] Length = 79 Score = 68.6 bits (166), Expect = 1e-13 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 36 GGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 71 >XP_003603336.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] AES73587.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 453 Score = 73.6 bits (179), Expect = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 225 AMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 AMGMKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 413 AMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 446 >XP_003603332.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNQ9.1 RecName: Full=Flotillin-like protein 2 ADA83095.1 flotillin-like protein 2 [Medicago truncatula] AES73583.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 480 Score = 73.6 bits (179), Expect = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 225 AMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 AMGMKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 440 AMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 473 >XP_003590560.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] AES60811.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 449 Score = 72.4 bits (176), Expect = 4e-13 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G +MGMKEVA VYKMLPPLFKTVHEQTGMLPPAW+G Sbjct: 406 GEGSMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWIG 442 >XP_013470396.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] KEH44434.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 473 Score = 72.4 bits (176), Expect = 4e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 225 AMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 +MGMKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 433 SMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 466 >XP_013468625.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] KEH42662.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 474 Score = 72.4 bits (176), Expect = 4e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 225 AMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 +MGMKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 434 SMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_014632416.1 PREDICTED: flotillin-like protein 3 [Glycine max] Length = 126 Score = 68.6 bits (166), Expect = 4e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GA+ G+KEVA VYKMLPPLFKTV EQTGMLPPAWMG Sbjct: 84 GASGGIKEVAGVYKMLPPLFKTVQEQTGMLPPAWMG 119 >XP_003603337.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNQ8.1 RecName: Full=Flotillin-like protein 1 ADA83094.1 flotillin-like protein 1 [Medicago truncatula] AES73588.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 478 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 225 AMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 AMGMKEVA VYKMLPPLFKTVHEQTGM PPAWMG Sbjct: 438 AMGMKEVAGVYKMLPPLFKTVHEQTGMFPPAWMG 471 >XP_007224585.1 hypothetical protein PRUPE_ppa1027148mg [Prunus persica] ONI34512.1 hypothetical protein PRUPE_1G485400 [Prunus persica] Length = 476 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GG+ MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 431 GGSNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_008219544.1 PREDICTED: flotillin-like protein 4 [Prunus mume] Length = 479 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GG+ MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 434 GGSNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 470 >XP_017257372.1 PREDICTED: flotillin-like protein 3 [Daucus carota subsp. sativus] KZM92081.1 hypothetical protein DCAR_020554 [Daucus carota subsp. sativus] Length = 472 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G GMKE+A VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 431 GDGNGMKEIAGVYKMLPPLFKTVHEQTGMLPPAWMG 466 >XP_007222834.1 hypothetical protein PRUPE_ppa005113mg [Prunus persica] ONI34513.1 hypothetical protein PRUPE_1G485500 [Prunus persica] Length = 476 Score = 70.1 bits (170), Expect = 3e-12 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GG MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 431 GGRNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_017421294.1 PREDICTED: flotillin-like protein 4 [Vigna angularis] KOM42022.1 hypothetical protein LR48_Vigan04g222000 [Vigna angularis] BAT78132.1 hypothetical protein VIGAN_02077300 [Vigna angularis var. angularis] Length = 474 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 219 GMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GMK+VANVYKMLPPLF TVHEQTGMLPPAWMG Sbjct: 436 GMKDVANVYKMLPPLFNTVHEQTGMLPPAWMG 467 >OMP12228.1 hypothetical protein COLO4_03388, partial [Corchorus olitorius] Length = 174 Score = 66.6 bits (161), Expect = 6e-12 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G + MKEVA VY+MLPPLFKTVHEQTGMLPP WMG Sbjct: 127 GTSNAMKEVAGVYRMLPPLFKTVHEQTGMLPPPWMG 162 >XP_013461876.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR0.1 RecName: Full=Flotillin-like protein 3 ADA83096.1 flotillin-like protein 3 [Medicago truncatula] KEH35911.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 474 Score = 68.6 bits (166), Expect = 9e-12 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 432 GGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_003603333.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR1.1 RecName: Full=Flotillin-like protein 4 ADA83097.1 flotillin-like protein 4 [Medicago truncatula] AES73584.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 475 Score = 68.6 bits (166), Expect = 9e-12 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 432 GGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_009382095.1 PREDICTED: flotillin-like protein 1 [Musa acuminata subsp. malaccensis] Length = 477 Score = 68.6 bits (166), Expect = 9e-12 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 GGA MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 436 GGA---MKEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 469 >XP_007226306.1 hypothetical protein PRUPE_ppa020951mg [Prunus persica] Length = 431 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 231 GAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G MKEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 383 GGHGAMKEVAEVYKMLPPLFKTVHEQTGMLPPAWMG 418 >XP_009362350.2 PREDICTED: flotillin-like protein 4 [Pyrus x bretschneideri] Length = 479 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 234 GGAAMGMKEVANVYKMLPPLFKTVHEQTGMLPPAWMG 124 G A+ MKEVA VYKMLPPLFKTVHEQTGM PPAWMG Sbjct: 434 GDASGAMKEVAGVYKMLPPLFKTVHEQTGMSPPAWMG 470