BLASTX nr result
ID: Glycyrrhiza35_contig00036675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00036675 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014498770.1 PREDICTED: myosin-2 [Vigna radiata var. radiata] 52 6e-06 KCW53781.1 hypothetical protein EUGRSUZ_J03029 [Eucalyptus grandis] 52 8e-06 XP_008377602.1 PREDICTED: titin homolog [Malus domestica] 52 8e-06 XP_010033909.1 PREDICTED: myosin heavy chain, muscle [Eucalyptus... 52 8e-06 >XP_014498770.1 PREDICTED: myosin-2 [Vigna radiata var. radiata] Length = 728 Score = 52.0 bits (123), Expect = 6e-06 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -3 Query: 223 EGVEKRKEQHRKEKGLVRSESAKVLRRIXXXXXXXXXGMKKGVDCIRKK 77 EG+EK KEQH+KEK L RSESA+ LRRI G++KGVD IRKK Sbjct: 654 EGMEK-KEQHKKEKRLPRSESARTLRRIPSSPSLLFGGIRKGVDYIRKK 701 >KCW53781.1 hypothetical protein EUGRSUZ_J03029 [Eucalyptus grandis] Length = 725 Score = 51.6 bits (122), Expect = 8e-06 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 229 SFEGVEKRKEQHRKEKGLVRSESAKVLRRIXXXXXXXXXGMKKGVDCIRKK 77 + EG E R E+ +KEKGLVRSESA++LRRI G+KKGVDCIRKK Sbjct: 644 NIEGKE-RGEKSKKEKGLVRSESARILRRI-PSSPSVILGLKKGVDCIRKK 692 >XP_008377602.1 PREDICTED: titin homolog [Malus domestica] Length = 745 Score = 51.6 bits (122), Expect = 8e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 229 SFEGVEKRKEQHRKEKGLVRSESAKVLRRIXXXXXXXXXGMKKGVDCIRKK 77 SFEG E+R + KE+ L RSESA+V RRI GMKKGVDCIRKK Sbjct: 665 SFEGRERRDHSNGKERKLTRSESARVFRRI-PSSPSIILGMKKGVDCIRKK 714 >XP_010033909.1 PREDICTED: myosin heavy chain, muscle [Eucalyptus grandis] Length = 751 Score = 51.6 bits (122), Expect = 8e-06 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 229 SFEGVEKRKEQHRKEKGLVRSESAKVLRRIXXXXXXXXXGMKKGVDCIRKK 77 + EG E R E+ +KEKGLVRSESA++LRRI G+KKGVDCIRKK Sbjct: 670 NIEGKE-RGEKSKKEKGLVRSESARILRRI-PSSPSVILGLKKGVDCIRKK 718