BLASTX nr result
ID: Glycyrrhiza35_contig00036238
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00036238 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN09255.1 hypothetical protein glysoja_043113 [Glycine soja] 51 8e-07 XP_006590781.1 PREDICTED: myosin-2-like [Glycine max] XP_0146194... 51 8e-07 KHN05486.1 hypothetical protein glysoja_020451 [Glycine soja] 50 1e-06 XP_006592033.1 PREDICTED: myosin-4-like [Glycine max] XP_0065920... 50 1e-06 XP_007131574.1 hypothetical protein PHAVU_011G024500g [Phaseolus... 47 2e-06 KYP68069.1 Laminin-like protein epi-1 [Cajanus cajan] 48 2e-06 >KHN09255.1 hypothetical protein glysoja_043113 [Glycine soja] Length = 1357 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ETHVQ G +SPI+NFKFILGVA VS++FGIIL Sbjct: 1322 ETHVQTGH-DSPIINFKFILGVALVSIVFGIIL 1353 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+S PSKRKS KK Sbjct: 1293 DIGSSLSIPSKRKSKKK 1309 >XP_006590781.1 PREDICTED: myosin-2-like [Glycine max] XP_014619416.1 PREDICTED: myosin-2-like [Glycine max] KRH29088.1 hypothetical protein GLYMA_11G096400 [Glycine max] Length = 1357 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ETHVQ G +SPI+NFKFILGVA VS++FGIIL Sbjct: 1322 ETHVQTGH-DSPIINFKFILGVALVSIVFGIIL 1353 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+S PSKRKS KK Sbjct: 1293 DIGSSLSIPSKRKSKKK 1309 >KHN05486.1 hypothetical protein glysoja_020451 [Glycine soja] Length = 1357 Score = 50.4 bits (119), Expect(2) = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ETHVQ G +SP++NFKFILGVA VS++FGIIL Sbjct: 1322 ETHVQTGH-DSPVINFKFILGVALVSIVFGIIL 1353 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+S PSKRKS KK Sbjct: 1293 DIGSSLSIPSKRKSKKK 1309 >XP_006592033.1 PREDICTED: myosin-4-like [Glycine max] XP_006592034.1 PREDICTED: myosin-4-like [Glycine max] KRH24114.1 hypothetical protein GLYMA_12G022500 [Glycine max] KRH24115.1 hypothetical protein GLYMA_12G022500 [Glycine max] Length = 1357 Score = 50.4 bits (119), Expect(2) = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ETHVQ G +SP++NFKFILGVA VS++FGIIL Sbjct: 1322 ETHVQTGH-DSPVINFKFILGVALVSIVFGIIL 1353 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+S PSKRKS KK Sbjct: 1293 DIGSSLSIPSKRKSKKK 1309 >XP_007131574.1 hypothetical protein PHAVU_011G024500g [Phaseolus vulgaris] ESW03568.1 hypothetical protein PHAVU_011G024500g [Phaseolus vulgaris] Length = 1357 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ET+VQ GQ +SP++N KFILGVA VS++FGIIL Sbjct: 1322 ETNVQSGQ-DSPVINLKFILGVALVSIVFGIIL 1353 Score = 31.6 bits (70), Expect(2) = 2e-06 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+STPSKRKS KK Sbjct: 1293 DIGSSLSTPSKRKSKKK 1309 >KYP68069.1 Laminin-like protein epi-1 [Cajanus cajan] Length = 859 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 128 ETHVQIGQANSPIMNFKFILGVAFVSVIFGIIL 226 ET+V+ GQ +SP++NFKFILGVA VS++FGIIL Sbjct: 824 ETNVRTGQ-DSPVINFKFILGVALVSIVFGIIL 855 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 3 DIGPSISTPSKRKSNKK 53 DIG S+STPSKRKS K+ Sbjct: 795 DIGSSLSTPSKRKSKKR 811