BLASTX nr result
ID: Glycyrrhiza35_contig00036069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00036069 (176 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007140499.1 hypothetical protein PHAVU_008G117800g [Phaseolus... 68 5e-12 OIV98625.1 hypothetical protein TanjilG_12748 [Lupinus angustifo... 68 7e-12 XP_019464878.1 PREDICTED: L-type lectin-domain containing recept... 68 7e-12 XP_003529112.1 PREDICTED: L-type lectin-domain containing recept... 66 3e-11 XP_003552189.1 PREDICTED: L-type lectin-domain containing recept... 63 4e-10 XP_014496468.1 PREDICTED: L-type lectin-domain containing recept... 63 4e-10 XP_002534539.1 PREDICTED: L-type lectin-domain containing recept... 62 6e-10 XP_017415959.1 PREDICTED: L-type lectin-domain containing recept... 62 6e-10 KYP37520.1 Lectin-domain containing receptor kinase A4.3 [Cajanu... 62 8e-10 XP_013448933.1 L-type lectin-domain receptor kinase IV.2-like pr... 61 2e-09 GAU37920.1 hypothetical protein TSUD_163570 [Trifolium subterran... 59 1e-08 XP_004492168.1 PREDICTED: L-type lectin-domain containing recept... 57 5e-08 CDP14359.1 unnamed protein product [Coffea canephora] 55 2e-07 OAY41352.1 hypothetical protein MANES_09G094700 [Manihot esculenta] 53 1e-06 CDP14364.1 unnamed protein product [Coffea canephora] 52 2e-06 XP_004492166.1 PREDICTED: L-type lectin-domain containing recept... 52 2e-06 XP_013448913.1 L-type lectin-domain receptor kinase IV.2-like pr... 52 2e-06 CDP14367.1 unnamed protein product [Coffea canephora] 52 2e-06 XP_002309076.2 hypothetical protein POPTR_0006s08960g, partial [... 52 3e-06 CDP14365.1 unnamed protein product [Coffea canephora] 52 4e-06 >XP_007140499.1 hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris] ESW12493.1 hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris] Length = 668 Score = 68.2 bits (165), Expect = 5e-12 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 TGLTFG H + QD PMS PSS+DRP SHTSSIAESLLSGGR Sbjct: 628 TGLTFGLHEDFQDCPMSYPSSMDRPISHTSSIAESLLSGGR 668 >OIV98625.1 hypothetical protein TanjilG_12748 [Lupinus angustifolius] Length = 602 Score = 67.8 bits (164), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 GLTFG H N QDFPMS PSS+DR FSH SS++ESLLSGGR Sbjct: 563 GLTFGHHENFQDFPMSYPSSMDRSFSHNSSVSESLLSGGR 602 >XP_019464878.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Lupinus angustifolius] Length = 668 Score = 67.8 bits (164), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 GLTFG H N QDFPMS PSS+DR FSH SS++ESLLSGGR Sbjct: 629 GLTFGHHENFQDFPMSYPSSMDRSFSHNSSVSESLLSGGR 668 >XP_003529112.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Glycine max] KHN40280.1 L-type lectin-domain containing receptor kinase IV.1 [Glycine soja] KRH49145.1 hypothetical protein GLYMA_07G135400 [Glycine max] Length = 667 Score = 66.2 bits (160), Expect = 3e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 GLTFG H + QD PMS PSS+DRP SHTSSIAESLLSGGR Sbjct: 628 GLTFGLHEDFQDCPMSYPSSMDRPISHTSSIAESLLSGGR 667 >XP_003552189.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Glycine max] KHN04723.1 L-type lectin-domain containing receptor kinase IV.1 [Glycine soja] KRH00016.1 hypothetical protein GLYMA_18G185400 [Glycine max] Length = 667 Score = 62.8 bits (151), Expect = 4e-10 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 GLTFG H + QD PMS PSS++RP SHTSSI ESLLSGGR Sbjct: 628 GLTFGLHEDFQDCPMSYPSSMNRPISHTSSIVESLLSGGR 667 >XP_014496468.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Vigna radiata var. radiata] Length = 670 Score = 62.8 bits (151), Expect = 4e-10 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 TGL FG H + QD PMS PSS+DRP S TSSIAESLLSGGR Sbjct: 630 TGLRFGLHEDFQDCPMSYPSSMDRPISRTSSIAESLLSGGR 670 >XP_002534539.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1 [Ricinus communis] EEF27843.1 kinase, putative [Ricinus communis] Length = 669 Score = 62.4 bits (150), Expect = 6e-10 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 +GL F +H DF MSCPSS+D+ FSHTS+IAESLLSGGR Sbjct: 629 SGLVFARHEGFDDFAMSCPSSMDKAFSHTSTIAESLLSGGR 669 >XP_017415959.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1 [Vigna angularis] KOM38048.1 hypothetical protein LR48_Vigan03g143000 [Vigna angularis] BAT84488.1 hypothetical protein VIGAN_04188300 [Vigna angularis var. angularis] Length = 670 Score = 62.4 bits (150), Expect = 6e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 TGL FG H + QD PMS PSS+DRP S TSS+AESLLSGGR Sbjct: 630 TGLRFGLHEDFQDCPMSYPSSMDRPISRTSSVAESLLSGGR 670 >KYP37520.1 Lectin-domain containing receptor kinase A4.3 [Cajanus cajan] Length = 668 Score = 62.0 bits (149), Expect = 8e-10 Identities = 32/42 (76%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 175 TGLTFGQHG-NVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 TGL FG H + QD PMS PSS+DRP SHTSSIAESLLSGGR Sbjct: 627 TGLNFGLHNEDFQDCPMSYPSSMDRPHSHTSSIAESLLSGGR 668 >XP_013448933.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] KEH22960.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] Length = 677 Score = 61.2 bits (147), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMSCPSS-LDRPFSHTSSIAESLLSGGR 53 GL++GQ N QDF MS PSS +DRPFSHTSSIAESLLSGGR Sbjct: 637 GLSYGQCENFQDFGMSYPSSSMDRPFSHTSSIAESLLSGGR 677 >GAU37920.1 hypothetical protein TSUD_163570 [Trifolium subterraneum] Length = 380 Score = 58.5 bits (140), Expect = 1e-08 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 172 GLTFGQHGNVQDFPMS-CPSSLDRPFSHTSSIAESLLSGGR 53 GLT GQ N QDF MS SS+DRPFSHTSSIAESLLSGGR Sbjct: 340 GLTSGQCENFQDFGMSYASSSMDRPFSHTSSIAESLLSGGR 380 >XP_004492168.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Cicer arietinum] Length = 675 Score = 57.0 bits (136), Expect = 5e-08 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 172 GLTF-GQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 GLT GQ N QDF MS PSS+DRP S+TSSIAESLLSGGR Sbjct: 635 GLTSSGQGENFQDFAMSYPSSMDRPISYTSSIAESLLSGGR 675 >CDP14359.1 unnamed protein product [Coffea canephora] Length = 673 Score = 55.5 bits (132), Expect = 2e-07 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSH-TSSIAESLLSGGR 53 TGL+F DF +SCPSS+D+PFSH +SS AESLLSGGR Sbjct: 632 TGLSFASQEGFSDFNLSCPSSMDKPFSHASSSAAESLLSGGR 673 >OAY41352.1 hypothetical protein MANES_09G094700 [Manihot esculenta] Length = 668 Score = 52.8 bits (125), Expect = 1e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 +GLTF DF MS PSS++ FSH+SSIAESLLSGGR Sbjct: 628 SGLTFANPEGFSDFAMSYPSSMNNAFSHSSSIAESLLSGGR 668 >CDP14364.1 unnamed protein product [Coffea canephora] Length = 665 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHT-SSIAESLLSGG 56 TGL+F H DF +S PSS+D+PFSHT SS+AESLLS G Sbjct: 624 TGLSFACHEGFSDFKLSYPSSMDKPFSHTSSSVAESLLSAG 664 >XP_004492166.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Cicer arietinum] Length = 668 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTS-SIAESLLSGGR 53 +GLTFG +DFP+S PS +D+ FSHTS SI +SLLSGGR Sbjct: 627 SGLTFGYREFFEDFPLSYPSDMDKTFSHTSVSITDSLLSGGR 668 >XP_013448913.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] KEH22940.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] Length = 671 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTS-SIAESLLSGGR 53 +GLTFG +DFP+S PSS+D+ SHTS SI++SLLSGGR Sbjct: 630 SGLTFGYQEYFEDFPLSYPSSMDKTMSHTSVSISDSLLSGGR 671 >CDP14367.1 unnamed protein product [Coffea canephora] Length = 672 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSS-IAESLLSGG 56 TGL+F H DF +S PSS+D+PFSHTSS +AESLLS G Sbjct: 631 TGLSFACHEGFSDFKLSYPSSMDKPFSHTSSFVAESLLSAG 671 >XP_002309076.2 hypothetical protein POPTR_0006s08960g, partial [Populus trichocarpa] EEE92599.2 hypothetical protein POPTR_0006s08960g, partial [Populus trichocarpa] Length = 220 Score = 51.6 bits (122), Expect = 3e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSHTSSIAESLLSGGR 53 +GLTF +F +S PSS+D+ F+H+SS+AESLLSGGR Sbjct: 180 SGLTFSHREGFDEFAISYPSSMDKAFAHSSSVAESLLSGGR 220 >CDP14365.1 unnamed protein product [Coffea canephora] Length = 655 Score = 51.6 bits (122), Expect = 4e-06 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -2 Query: 175 TGLTFGQHGNVQDFPMSCPSSLDRPFSH-TSSIAESLLSGGR 53 TGL+F DF +S PSS+D+PFSH +SS AESLLSGGR Sbjct: 614 TGLSFASQEGFSDFKLSYPSSMDKPFSHASSSAAESLLSGGR 655