BLASTX nr result
ID: Glycyrrhiza35_contig00035852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00035852 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012087853.1 PREDICTED: uncharacterized protein LOC105646592 [... 91 2e-19 KRH49386.1 hypothetical protein GLYMA_07G150500 [Glycine max] 90 2e-19 KHN46943.1 Putative E3 ubiquitin-protein ligase XBAT34 [Glycine ... 90 3e-19 KHN36429.1 Putative E3 ubiquitin-protein ligase XBAT35 [Glycine ... 90 3e-19 XP_006583656.1 PREDICTED: uncharacterized protein LOC100777141 [... 90 3e-19 XP_006602668.1 PREDICTED: uncharacterized protein LOC100791057 [... 90 3e-19 XP_012575238.1 PREDICTED: uncharacterized protein LOC101489056 [... 90 4e-19 OAY41479.1 hypothetical protein MANES_09G105000 [Manihot esculen... 90 4e-19 GAU27447.1 hypothetical protein TSUD_161330 [Trifolium subterran... 90 5e-19 XP_014522557.1 PREDICTED: uncharacterized protein LOC106779042 i... 89 6e-19 XP_014522556.1 PREDICTED: uncharacterized protein LOC106779042 i... 89 8e-19 XP_014522555.1 PREDICTED: uncharacterized protein LOC106779042 i... 89 9e-19 XP_017415852.1 PREDICTED: uncharacterized protein LOC108326798 [... 89 1e-18 KYP33595.1 E3 ubiquitin-protein ligase rififylin [Cajanus cajan] 89 1e-18 XP_007026703.2 PREDICTED: uncharacterized protein LOC18597543 is... 88 2e-18 EOY07205.1 RING/U-box superfamily protein, putative isoform 4 [T... 88 2e-18 XP_007026701.2 PREDICTED: uncharacterized protein LOC18597543 is... 88 2e-18 EOY07203.1 RING/U-box superfamily protein, putative isoform 2 [T... 88 2e-18 EOY07204.1 RING/U-box superfamily protein, putative isoform 3 [T... 88 2e-18 XP_019460162.1 PREDICTED: uncharacterized protein LOC109359922 [... 87 2e-18 >XP_012087853.1 PREDICTED: uncharacterized protein LOC105646592 [Jatropha curcas] KDP24449.1 hypothetical protein JCGZ_25013 [Jatropha curcas] Length = 481 Score = 91.3 bits (225), Expect = 2e-19 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRIVEAAGTCP+CRRNMKKVRKIFTV Sbjct: 442 FLPCGHCVACFACGTRIVEAAGTCPICRRNMKKVRKIFTV 481 >KRH49386.1 hypothetical protein GLYMA_07G150500 [Glycine max] Length = 373 Score = 90.1 bits (222), Expect = 2e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 334 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 373 >KHN46943.1 Putative E3 ubiquitin-protein ligase XBAT34 [Glycine soja] Length = 395 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 356 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 395 >KHN36429.1 Putative E3 ubiquitin-protein ligase XBAT35 [Glycine soja] Length = 402 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 363 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 402 >XP_006583656.1 PREDICTED: uncharacterized protein LOC100777141 [Glycine max] KRH49385.1 hypothetical protein GLYMA_07G150500 [Glycine max] Length = 439 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 400 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 439 >XP_006602668.1 PREDICTED: uncharacterized protein LOC100791057 [Glycine max] KRH00240.1 hypothetical protein GLYMA_18G201500 [Glycine max] Length = 440 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 401 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 440 >XP_012575238.1 PREDICTED: uncharacterized protein LOC101489056 [Cicer arietinum] Length = 453 Score = 90.1 bits (222), Expect = 4e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 414 FLPCGHCVACFACGTRIAEAAGTCPVCRRNMKKVRKIFTV 453 >OAY41479.1 hypothetical protein MANES_09G105000 [Manihot esculenta] OAY41480.1 hypothetical protein MANES_09G105000 [Manihot esculenta] Length = 477 Score = 90.1 bits (222), Expect = 4e-19 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCV+CFACGTRIVEAAGTCP+CRRNMKKVRKIFTV Sbjct: 438 FLPCGHCVSCFACGTRIVEAAGTCPICRRNMKKVRKIFTV 477 >GAU27447.1 hypothetical protein TSUD_161330 [Trifolium subterraneum] Length = 463 Score = 89.7 bits (221), Expect = 5e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACF CGTRIVEAAGTCPVCRRNMKKVRKIFTV Sbjct: 424 FLPCGHCVACFECGTRIVEAAGTCPVCRRNMKKVRKIFTV 463 >XP_014522557.1 PREDICTED: uncharacterized protein LOC106779042 isoform X3 [Vigna radiata var. radiata] Length = 375 Score = 89.0 bits (219), Expect = 6e-19 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EA+GTCPVCRRNMKKVRKIFTV Sbjct: 336 FLPCGHCVACFACGTRIAEASGTCPVCRRNMKKVRKIFTV 375 >XP_014522556.1 PREDICTED: uncharacterized protein LOC106779042 isoform X2 [Vigna radiata var. radiata] Length = 422 Score = 89.0 bits (219), Expect = 8e-19 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EA+GTCPVCRRNMKKVRKIFTV Sbjct: 383 FLPCGHCVACFACGTRIAEASGTCPVCRRNMKKVRKIFTV 422 >XP_014522555.1 PREDICTED: uncharacterized protein LOC106779042 isoform X1 [Vigna radiata var. radiata] Length = 444 Score = 89.0 bits (219), Expect = 9e-19 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EA+GTCPVCRRNMKKVRKIFTV Sbjct: 405 FLPCGHCVACFACGTRIAEASGTCPVCRRNMKKVRKIFTV 444 >XP_017415852.1 PREDICTED: uncharacterized protein LOC108326798 [Vigna angularis] KOM37496.1 hypothetical protein LR48_Vigan03g087800 [Vigna angularis] BAT84099.1 hypothetical protein VIGAN_04137100 [Vigna angularis var. angularis] Length = 464 Score = 89.0 bits (219), Expect = 1e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACGTRI EA+GTCPVCRRNMKKVRKIFTV Sbjct: 425 FLPCGHCVACFACGTRIAEASGTCPVCRRNMKKVRKIFTV 464 >KYP33595.1 E3 ubiquitin-protein ligase rififylin [Cajanus cajan] Length = 416 Score = 88.6 bits (218), Expect = 1e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCPVCRRNMKKVRKIFTV Sbjct: 377 FLPCGHCVACFACGSRIAEAAGTCPVCRRNMKKVRKIFTV 416 >XP_007026703.2 PREDICTED: uncharacterized protein LOC18597543 isoform X2 [Theobroma cacao] Length = 484 Score = 88.2 bits (217), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCP+CRRNMKKVRKIFTV Sbjct: 445 FLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV 484 >EOY07205.1 RING/U-box superfamily protein, putative isoform 4 [Theobroma cacao] Length = 484 Score = 88.2 bits (217), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCP+CRRNMKKVRKIFTV Sbjct: 445 FLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV 484 >XP_007026701.2 PREDICTED: uncharacterized protein LOC18597543 isoform X1 [Theobroma cacao] Length = 488 Score = 88.2 bits (217), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCP+CRRNMKKVRKIFTV Sbjct: 449 FLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV 488 >EOY07203.1 RING/U-box superfamily protein, putative isoform 2 [Theobroma cacao] Length = 488 Score = 88.2 bits (217), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCP+CRRNMKKVRKIFTV Sbjct: 449 FLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV 488 >EOY07204.1 RING/U-box superfamily protein, putative isoform 3 [Theobroma cacao] Length = 491 Score = 88.2 bits (217), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFTV 165 FLPCGHCVACFACG+RI EAAGTCP+CRRNMKKVRKIFTV Sbjct: 452 FLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV 491 >XP_019460162.1 PREDICTED: uncharacterized protein LOC109359922 [Lupinus angustifolius] Length = 360 Score = 87.4 bits (215), Expect = 2e-18 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 284 FLPCGHCVACFACGTRIVEAAGTCPVCRRNMKKVRKIFT 168 FLPCGHCVACFACGTRI EA+GTCPVCRRNMKKVRKIFT Sbjct: 321 FLPCGHCVACFACGTRIAEASGTCPVCRRNMKKVRKIFT 359