BLASTX nr result
ID: Glycyrrhiza35_contig00035572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00035572 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU50408.1 hypothetical protein TSUD_244550 [Trifolium subterran... 65 9e-11 GAU46403.1 hypothetical protein TSUD_28190 [Trifolium subterraneum] 60 3e-09 XP_003613114.1 PIF1 DNA helicase/replication A1-like protein, pu... 55 3e-08 XP_003595510.1 replication factor-A carboxy-terminal domain prot... 55 5e-07 >GAU50408.1 hypothetical protein TSUD_244550 [Trifolium subterraneum] Length = 340 Score = 65.1 bits (157), Expect = 9e-11 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 204 MAAIHDSVSSIGPAKDNLSIVVKVVRLWTVTDMNRPNIKFSMEMVLMDDK 55 MA HD++S I PAK+N +++V+VVRLW V DM R + FSMEMVLMD K Sbjct: 1 MAPKHDAISEISPAKENWNLIVRVVRLWYVKDMARDKLPFSMEMVLMDSK 50 >GAU46403.1 hypothetical protein TSUD_28190 [Trifolium subterraneum] Length = 197 Score = 59.7 bits (143), Expect = 3e-09 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -3 Query: 204 MAAIHDSVSSIGPAKDNLSIVVKVVRLWTVTDMNRPNIKFSMEMVLMDDK 55 MA HD++S I AK+N +++V+VVRLW V DM R + FSMEM+LMD K Sbjct: 1 MAPKHDAISEISLAKENWNLIVRVVRLWYVKDMIRDKLPFSMEMMLMDSK 50 >XP_003613114.1 PIF1 DNA helicase/replication A1-like protein, putative [Medicago truncatula] AES96072.1 PIF1 DNA helicase/replication A1-like protein, putative [Medicago truncatula] Length = 96 Score = 55.1 bits (131), Expect = 3e-08 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = -3 Query: 189 DSVSSIGPAKDNLSIVVKVVRLWTVTDMNRPNIKFSMEMVLMDDK 55 D +S I P+K+N +I+V+VVRLW V D+ + FS+EMVLMD+K Sbjct: 6 DLISDISPSKENRTIIVRVVRLWFVRDIKKDQFPFSLEMVLMDNK 50 >XP_003595510.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES65761.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 549 Score = 54.7 bits (130), Expect = 5e-07 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -3 Query: 204 MAAIHDSVSSIGPAKDNLSIVVKVVRLWTVTDMNRPNIKFSMEMVLMDDK 55 MA D +S I P+K+N +I V+VVRLW V DM + + +S+EMVLMD+K Sbjct: 1 MAPKIDLISDISPSKENWNIRVRVVRLWFVRDMKKDQLPYSLEMVLMDNK 50