BLASTX nr result
ID: Glycyrrhiza35_contig00035449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00035449 (656 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013466036.1 salt stress response/antifungal domain protein [M... 106 4e-24 XP_013469932.1 cysteine-rich RLK (receptor-like kinase) protein ... 95 5e-20 XP_013469931.1 cysteine-rich RLK (receptor-like kinase) protein ... 95 7e-20 XP_014511962.1 PREDICTED: cysteine-rich receptor-like protein ki... 94 8e-20 KOM36179.1 hypothetical protein LR48_Vigan02g232900 [Vigna angul... 94 2e-19 BAT93984.1 hypothetical protein VIGAN_08054600 [Vigna angularis ... 94 2e-19 XP_003589297.2 cysteine-rich receptor-kinase-like protein [Medic... 95 5e-19 AFK43013.1 unknown [Medicago truncatula] 92 6e-19 GAU15359.1 hypothetical protein TSUD_04280 [Trifolium subterraneum] 94 1e-18 KRH35619.1 hypothetical protein GLYMA_10G254000 [Glycine max] 92 1e-18 XP_017413205.1 PREDICTED: cysteine-rich receptor-like protein ki... 94 1e-18 XP_014513307.1 PREDICTED: cysteine-rich receptor-like protein ki... 91 1e-18 KOM36175.1 hypothetical protein LR48_Vigan02g232500 [Vigna angul... 90 2e-18 XP_013466034.1 cysteine-rich receptor-kinase-like protein [Medic... 93 2e-18 XP_019441546.1 PREDICTED: cysteine-rich repeat secretory protein... 91 3e-18 XP_019441545.1 PREDICTED: cysteine-rich repeat secretory protein... 91 3e-18 XP_017414218.1 PREDICTED: cysteine-rich receptor-like protein ki... 90 3e-18 XP_019441544.1 PREDICTED: cysteine-rich repeat secretory protein... 91 3e-18 OIW12840.1 hypothetical protein TanjilG_24773 [Lupinus angustifo... 91 3e-18 XP_019441543.1 PREDICTED: cysteine-rich repeat secretory protein... 91 4e-18 >XP_013466036.1 salt stress response/antifungal domain protein [Medicago truncatula] KEH40075.1 salt stress response/antifungal domain protein [Medicago truncatula] Length = 313 Score = 106 bits (265), Expect = 4e-24 Identities = 52/101 (51%), Positives = 60/101 (59%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPAAD 182 YGLVQCTPDL CD+CLV+SIKEI CCNN++GARIVRPSCNLRYETNS FY+P +D Sbjct: 199 YGLVQCTPDLSKTLCDDCLVQSIKEISNCCNNRLGARIVRPSCNLRYETNSFFYQPTPSD 258 Query: 183 XXXXXXXXXXXXXXXXXXXXXXXXXXXQDKDNTTRTAIAKI 305 QDK NT+R + I Sbjct: 259 SPSPSPVPVPVPSFSTPPPFAQNNTSSQDKGNTSRNVVPVI 299 >XP_013469932.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] KEH43970.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] Length = 265 Score = 94.7 bits (234), Expect = 5e-20 Identities = 38/58 (65%), Positives = 50/58 (86%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGLVQCTPDL QCD+CL++SI E+ +CC+N++GARI+RPSCNLR+ET+ FY+P A Sbjct: 201 YGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSNRIGARIIRPSCNLRFETSYQFYQPKA 258 >XP_013469931.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] KEH43969.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] Length = 282 Score = 94.7 bits (234), Expect = 7e-20 Identities = 38/58 (65%), Positives = 50/58 (86%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGLVQCTPDL QCD+CL++SI E+ +CC+N++GARI+RPSCNLR+ET+ FY+P A Sbjct: 218 YGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSNRIGARIIRPSCNLRFETSYQFYQPKA 275 >XP_014511962.1 PREDICTED: cysteine-rich receptor-like protein kinase 29 [Vigna radiata var. radiata] Length = 246 Score = 94.0 bits (232), Expect = 8e-20 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFY 164 YGLVQCTPDL CDNCL++SI E+P CC++K+G RIVRPSCNLRYET+S FY Sbjct: 129 YGLVQCTPDLSGPDCDNCLLQSINEVPNCCHSKIGTRIVRPSCNLRYETSSLFY 182 >KOM36179.1 hypothetical protein LR48_Vigan02g232900 [Vigna angularis] Length = 296 Score = 94.0 bits (232), Expect = 2e-19 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFY 164 YGLVQCTPDL CDNCL++SI E+P CC++K+G RIVRPSCNLRYET+S FY Sbjct: 181 YGLVQCTPDLSGPDCDNCLLQSINEVPNCCDSKIGTRIVRPSCNLRYETSSLFY 234 >BAT93984.1 hypothetical protein VIGAN_08054600 [Vigna angularis var. angularis] Length = 316 Score = 94.0 bits (232), Expect = 2e-19 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFY 164 YGLVQCTPDL CDNCL++SI E+P CC++K+G RIVRPSCNLRYET+S FY Sbjct: 201 YGLVQCTPDLSGPDCDNCLLQSINEVPNCCDSKIGTRIVRPSCNLRYETSSLFY 254 >XP_003589297.2 cysteine-rich receptor-kinase-like protein [Medicago truncatula] AES59548.2 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 670 Score = 95.1 bits (235), Expect = 5e-19 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPAA 179 YGLVQCTPDL C++CLVE++++IP CCNNK+G R+VRPSCN+R+ET+ FYEP A+ Sbjct: 199 YGLVQCTPDLSETDCNSCLVENLQQIPSCCNNKIGGRVVRPSCNMRFETSYLFYEPRAS 257 >AFK43013.1 unknown [Medicago truncatula] Length = 265 Score = 92.0 bits (227), Expect = 6e-19 Identities = 37/58 (63%), Positives = 49/58 (84%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGLVQCTPDL QCD+CL++SI E+ +CC+N++ ARI+RPSCNLR+ET+ FY+P A Sbjct: 201 YGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSNRIDARIIRPSCNLRFETSYQFYQPKA 258 >GAU15359.1 hypothetical protein TSUD_04280 [Trifolium subterraneum] Length = 543 Score = 94.0 bits (232), Expect = 1e-18 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPAA 179 YGLVQCTPDL C++CL ES+++IP CCNNK+G R+VRPSCN+R+ET+ FYEP A+ Sbjct: 71 YGLVQCTPDLSESDCNSCLGESLQQIPSCCNNKIGGRVVRPSCNMRFETSFLFYEPRAS 129 >KRH35619.1 hypothetical protein GLYMA_10G254000 [Glycine max] Length = 319 Score = 92.0 bits (227), Expect = 1e-18 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGLVQCTP+L QCD+CLV+SIKE+ CCN+++G RIVRPSCNLR+ET S FY PA Sbjct: 204 YGLVQCTPNLSGPQCDDCLVQSIKEVSHCCNSRLGVRIVRPSCNLRFETASLFYGTPA 261 >XP_017413205.1 PREDICTED: cysteine-rich receptor-like protein kinase 29 [Vigna angularis] Length = 1011 Score = 94.0 bits (232), Expect = 1e-18 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFY 164 YGLVQCTPDL CDNCL++SI E+P CC++K+G RIVRPSCNLRYET+S FY Sbjct: 201 YGLVQCTPDLSGPDCDNCLLQSINEVPNCCDSKIGTRIVRPSCNLRYETSSLFY 254 Score = 81.6 bits (200), Expect = 2e-14 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIP-KCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGLVQCTPDL +C +CL +SI+ IP CC +K+G R+VRPSCN+R+ET+ FY PA Sbjct: 535 YGLVQCTPDLEESECADCLSQSIERIPIDCCKDKIGGRVVRPSCNMRFETSFKFYGDPA 593 >XP_014513307.1 PREDICTED: cysteine-rich receptor-like protein kinase 26 [Vigna radiata var. radiata] Length = 260 Score = 90.9 bits (224), Expect = 1e-18 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGL QCTPDL QC +CLV+SI E+P+CCNN++GARI+RPSC +RYET+ F+ PPA Sbjct: 200 YGLAQCTPDLIGPQCLDCLVQSIAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPA 257 >KOM36175.1 hypothetical protein LR48_Vigan02g232500 [Vigna angularis] Length = 244 Score = 90.1 bits (222), Expect = 2e-18 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGL QCTPDL +C +CLV+SI E+P+CCNN++GARI+RPSC +RYET+ F+ PPA Sbjct: 184 YGLAQCTPDLSGPRCLDCLVQSIAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPA 241 >XP_013466034.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] KEH40073.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 667 Score = 93.2 bits (230), Expect = 2e-18 Identities = 42/63 (66%), Positives = 51/63 (80%), Gaps = 4/63 (6%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFY----EP 170 Y LVQCTPDL CD+CLV+SIK IP+CCNN++GARIVRPSC LRYET+S FY +P Sbjct: 199 YALVQCTPDLSKSLCDDCLVKSIKAIPRCCNNRLGARIVRPSCYLRYETDSLFYQQTPDP 258 Query: 171 PAA 179 P++ Sbjct: 259 PSS 261 >XP_019441546.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X4 [Lupinus angustifolius] Length = 299 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYE 167 YGL QCTPDL + +C CL ESI IP CCNN++GARIVRPSCNLRYET FYE Sbjct: 195 YGLAQCTPDLTLSECSFCLNESISVIPSCCNNRIGARIVRPSCNLRYETGFPFYE 249 >XP_019441545.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X3 [Lupinus angustifolius] Length = 302 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYE 167 YGL QCTPDL + +C CL ESI IP CCNN++GARIVRPSCNLRYET FYE Sbjct: 195 YGLAQCTPDLTLSECSFCLNESISVIPSCCNNRIGARIVRPSCNLRYETGFPFYE 249 >XP_017414218.1 PREDICTED: cysteine-rich receptor-like protein kinase 26 [Vigna angularis] BAT93989.1 hypothetical protein VIGAN_08055100 [Vigna angularis var. angularis] Length = 260 Score = 90.1 bits (222), Expect = 3e-18 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYEPPA 176 YGL QCTPDL +C +CLV+SI E+P+CCNN++GARI+RPSC +RYET+ F+ PPA Sbjct: 200 YGLAQCTPDLSGPRCLDCLVQSIAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPA 257 >XP_019441544.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X2 [Lupinus angustifolius] Length = 308 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYE 167 YGL QCTPDL + +C CL ESI IP CCNN++GARIVRPSCNLRYET FYE Sbjct: 195 YGLAQCTPDLTLSECSFCLNESISVIPSCCNNRIGARIVRPSCNLRYETGFPFYE 249 >OIW12840.1 hypothetical protein TanjilG_24773 [Lupinus angustifolius] Length = 320 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYE 167 YGL QCTPDL + +C CL ESI IP CCNN++GARIVRPSCNLRYET FYE Sbjct: 195 YGLAQCTPDLTLSECSFCLNESISVIPSCCNNRIGARIVRPSCNLRYETGFPFYE 249 >XP_019441543.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X1 [Lupinus angustifolius] Length = 333 Score = 90.9 bits (224), Expect = 4e-18 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +3 Query: 3 YGLVQCTPDLPMQQCDNCLVESIKEIPKCCNNKVGARIVRPSCNLRYETNSSFYE 167 YGL QCTPDL + +C CL ESI IP CCNN++GARIVRPSCNLRYET FYE Sbjct: 195 YGLAQCTPDLTLSECSFCLNESISVIPSCCNNRIGARIVRPSCNLRYETGFPFYE 249