BLASTX nr result
ID: Glycyrrhiza35_contig00035248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00035248 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EQM36023.1 hypothetical protein B571_24830 [Salmonella enterica ... 67 1e-13 >EQM36023.1 hypothetical protein B571_24830 [Salmonella enterica subsp. enterica serovar Typhimurium str. STm1] EQM57925.1 hypothetical protein B578_25935 [Salmonella enterica subsp. enterica serovar Typhimurium str. STm10] Length = 33 Score = 67.4 bits (163), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF 95 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF Sbjct: 3 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF 33