BLASTX nr result
ID: Glycyrrhiza35_contig00034802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00034802 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcri... 82 1e-15 XP_013449700.1 mediator of RNA polymerase II transcription subun... 74 1e-12 XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcri... 72 6e-12 XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angul... 69 1e-11 BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis ... 69 1e-11 KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] 71 1e-11 XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcri... 71 1e-11 GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium ... 70 2e-11 XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcri... 70 2e-11 XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcri... 70 2e-11 XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcri... 70 2e-11 XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcri... 70 2e-11 BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis ... 66 3e-11 XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcri... 70 3e-11 KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] 70 3e-11 OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifo... 70 3e-11 XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcri... 70 3e-11 XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcri... 70 3e-11 >XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Cicer arietinum] Length = 1339 Score = 82.4 bits (202), Expect = 1e-15 Identities = 42/65 (64%), Positives = 48/65 (73%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLLXXXXXXXXXXXXXXIIQ 232 SGFV LMVGCTPMWVRE D++LLKRLS+GLR+L+EHELALRLL II+ Sbjct: 1275 SGFVGLMVGCTPMWVREADVELLKRLSKGLRQLDEHELALRLLEIGGIGVMGAAAEMIIE 1334 Query: 231 FERRL 217 ERRL Sbjct: 1335 IERRL 1339 >XP_013449700.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] KEH23728.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] Length = 1338 Score = 73.9 bits (180), Expect = 1e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSL+V CTPMW+REVD +LLKRLS+GLR+LNE ELALRLL Sbjct: 1274 SGFVSLIVCCTPMWIREVDAELLKRLSKGLRQLNEDELALRLL 1316 >XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33B-like [Arachis ipaensis] Length = 414 Score = 71.6 bits (174), Expect = 6e-12 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 350 SGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 392 >XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Lupinus angustifolius] OIV95872.1 hypothetical protein TanjilG_06848 [Lupinus angustifolius] Length = 1329 Score = 71.6 bits (174), Expect = 7e-12 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+D+LKRLS GLR LNE ELAL LL Sbjct: 1267 SGFVSLMVGCTPNWVLEVDVDVLKRLSNGLRRLNEEELALALL 1309 >XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1334 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 1270 SGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 1312 >KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angularis] Length = 181 Score = 68.6 bits (166), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 119 SGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 161 >BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis var. angularis] Length = 187 Score = 68.6 bits (166), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 125 SGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 167 >KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] Length = 650 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 589 SGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 631 >XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A [Jatropha curcas] Length = 1323 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 1262 SGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 1304 >GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium subterraneum] Length = 1330 Score = 70.5 bits (171), Expect = 2e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+++LKRLS GLR+LNE ELAL LL Sbjct: 1268 SGFVSLMVGCTPNWVLEVDVNVLKRLSNGLRQLNEEELALSLL 1310 >XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis ipaensis] Length = 1131 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1069 SGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1111 >XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis duranensis] Length = 1320 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1258 SGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1300 >XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1324 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1262 SGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1304 >XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Arachis ipaensis] Length = 1331 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1269 SGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1311 >BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis var. angularis] Length = 137 Score = 66.2 bits (160), Expect = 3e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMV CTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 75 SGFVSLMVDCTPNWVLEVDVHVLKRLSNGLRQLNEEELALVLL 117 >XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis duranensis] Length = 1131 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1069 SGFVSLMVGCTPNWVLEVDVSVLKRLSMGLRQLNEEELALSLL 1111 >KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] Length = 1132 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1070 SGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1112 >OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifolius] Length = 1187 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 +GFVSLMV CTP+WV EVD D+LKRLSRGL LNE+ELA RLL Sbjct: 1123 TGFVSLMVACTPLWVPEVDADILKRLSRGLIRLNEYELAFRLL 1165 >XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Glycine max] Length = 1195 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1133 SGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1175 >XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A isoform X3 [Nelumbo nucifera] Length = 1213 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 411 SGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 283 SGFVSLMVGCTP WV EV++D+LKRLS+GLR+ NE ELAL LL Sbjct: 1151 SGFVSLMVGCTPTWVLEVEVDVLKRLSKGLRQWNEEELALALL 1193