BLASTX nr result
ID: Glycyrrhiza35_contig00034746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00034746 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW49928.1 hypothetical protein EUGRSUZ_K033901, partial [Eucaly... 70 2e-13 GAU47162.1 hypothetical protein TSUD_28850 [Trifolium subterraneum] 70 3e-13 XP_002320391.1 hypothetical protein POPTR_0014s13470g [Populus t... 70 4e-13 KZM95173.1 hypothetical protein DCAR_018415 [Daucus carota subsp... 65 2e-11 XP_016696084.1 PREDICTED: protein HUA2-LIKE 3-like isoform X2 [G... 70 3e-11 XP_017630478.1 PREDICTED: protein HUA2-LIKE 3-like isoform X5 [G... 70 3e-11 XP_016709649.1 PREDICTED: protein HUA2-LIKE 3-like isoform X4 [G... 70 3e-11 XP_012490535.1 PREDICTED: HUA2-like protein 2 isoform X3 [Gossyp... 70 3e-11 XP_016709272.1 PREDICTED: protein HUA2-LIKE 3-like [Gossypium hi... 70 3e-11 XP_017630477.1 PREDICTED: protein HUA2-LIKE 3-like isoform X4 [G... 70 3e-11 XP_015950906.1 PREDICTED: LOW QUALITY PROTEIN: protein HUA2-LIKE... 70 3e-11 KVH94384.1 CID domain-containing protein [Cynara cardunculus var... 70 3e-11 XP_010090371.1 hypothetical protein L484_025036 [Morus notabilis... 70 3e-11 KOM34989.1 hypothetical protein LR48_Vigan02g113900 [Vigna angul... 70 3e-11 XP_017630610.1 PREDICTED: protein HUA2-LIKE 3-like [Gossypium ar... 70 3e-11 XP_016696086.1 PREDICTED: protein HUA2-LIKE 3-like isoform X2 [G... 70 3e-11 XP_016696082.1 PREDICTED: protein HUA2-LIKE 3-like isoform X1 [G... 70 3e-11 KJB42063.1 hypothetical protein B456_007G134800 [Gossypium raimo... 70 3e-11 XP_012490536.1 PREDICTED: HUA2-like protein 2 [Gossypium raimond... 70 3e-11 XP_007199681.1 hypothetical protein PRUPE_ppa000261mg [Prunus pe... 70 3e-11 >KCW49928.1 hypothetical protein EUGRSUZ_K033901, partial [Eucalyptus grandis] Length = 66 Score = 70.5 bits (171), Expect = 2e-13 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >GAU47162.1 hypothetical protein TSUD_28850 [Trifolium subterraneum] Length = 78 Score = 70.5 bits (171), Expect = 3e-13 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 32 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 61 >XP_002320391.1 hypothetical protein POPTR_0014s13470g [Populus trichocarpa] EEE98706.1 hypothetical protein POPTR_0014s13470g [Populus trichocarpa] Length = 97 Score = 70.5 bits (171), Expect = 4e-13 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 22 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 51 >KZM95173.1 hypothetical protein DCAR_018415 [Daucus carota subsp. sativus] Length = 67 Score = 65.1 bits (157), Expect = 2e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPA VSEP+KWG+ Sbjct: 21 QWKVGDLVLAKVKGFPAWPAKVSEPDKWGH 50 >XP_016696084.1 PREDICTED: protein HUA2-LIKE 3-like isoform X2 [Gossypium hirsutum] Length = 1171 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_017630478.1 PREDICTED: protein HUA2-LIKE 3-like isoform X5 [Gossypium arboreum] XP_017630479.1 PREDICTED: protein HUA2-LIKE 3-like isoform X5 [Gossypium arboreum] Length = 1178 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_016709649.1 PREDICTED: protein HUA2-LIKE 3-like isoform X4 [Gossypium hirsutum] Length = 1178 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_012490535.1 PREDICTED: HUA2-like protein 2 isoform X3 [Gossypium raimondii] Length = 1178 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_016709272.1 PREDICTED: protein HUA2-LIKE 3-like [Gossypium hirsutum] Length = 1180 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_017630477.1 PREDICTED: protein HUA2-LIKE 3-like isoform X4 [Gossypium arboreum] Length = 1203 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_015950906.1 PREDICTED: LOW QUALITY PROTEIN: protein HUA2-LIKE 2 [Arachis duranensis] Length = 1349 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >KVH94384.1 CID domain-containing protein [Cynara cardunculus var. scolymus] Length = 1350 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_010090371.1 hypothetical protein L484_025036 [Morus notabilis] EXB39341.1 hypothetical protein L484_025036 [Morus notabilis] Length = 1356 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >KOM34989.1 hypothetical protein LR48_Vigan02g113900 [Vigna angularis] Length = 1371 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_017630610.1 PREDICTED: protein HUA2-LIKE 3-like [Gossypium arboreum] XP_017630611.1 PREDICTED: protein HUA2-LIKE 3-like [Gossypium arboreum] Length = 1374 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_016696086.1 PREDICTED: protein HUA2-LIKE 3-like isoform X2 [Gossypium hirsutum] Length = 1375 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_016696082.1 PREDICTED: protein HUA2-LIKE 3-like isoform X1 [Gossypium hirsutum] XP_016696083.1 PREDICTED: protein HUA2-LIKE 3-like isoform X1 [Gossypium hirsutum] Length = 1375 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >KJB42063.1 hypothetical protein B456_007G134800 [Gossypium raimondii] KJB42065.1 hypothetical protein B456_007G134800 [Gossypium raimondii] Length = 1375 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_012490536.1 PREDICTED: HUA2-like protein 2 [Gossypium raimondii] KJB42072.1 hypothetical protein B456_007G135000 [Gossypium raimondii] Length = 1377 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50 >XP_007199681.1 hypothetical protein PRUPE_ppa000261mg [Prunus persica] Length = 1379 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 366 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 455 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY Sbjct: 21 QWKVGDLVLAKVKGFPAWPATVSEPEKWGY 50