BLASTX nr result
ID: Glycyrrhiza35_contig00034171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00034171 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH75291.1 hypothetical protein GLYMA_01G076100 [Glycine max] 76 1e-14 XP_006573219.1 PREDICTED: probable plastid-lipid-associated prot... 76 1e-14 XP_014629447.1 PREDICTED: probable plastid-lipid-associated prot... 76 2e-14 KHN42525.1 Putative plastid-lipid-associated protein 11, chlorop... 71 7e-14 XP_013448320.1 plastid lipid-associated protein [Medicago trunca... 73 8e-14 XP_017419220.1 PREDICTED: probable plastid-lipid-associated prot... 73 1e-13 XP_014498281.1 PREDICTED: probable plastid-lipid-associated prot... 73 1e-13 XP_015971671.1 PREDICTED: probable plastid-lipid-associated prot... 72 4e-13 XP_004514232.1 PREDICTED: probable plastid-lipid-associated prot... 71 5e-13 XP_007140979.1 hypothetical protein PHAVU_008G157000g [Phaseolus... 71 7e-13 XP_019462226.1 PREDICTED: probable plastid-lipid-associated prot... 71 8e-13 KYP54480.1 hypothetical protein KK1_000668 [Cajanus cajan] 70 1e-12 XP_014498282.1 PREDICTED: probable plastid-lipid-associated prot... 69 3e-12 XP_003538066.1 PREDICTED: probable plastid-lipid-associated prot... 69 4e-12 XP_009411573.1 PREDICTED: probable plastid-lipid-associated prot... 68 8e-12 XP_019188928.1 PREDICTED: probable plastid-lipid-associated prot... 67 2e-11 KVH88245.1 Plastid lipid-associated protein/fibrillin conserved ... 67 2e-11 XP_019462229.1 PREDICTED: probable plastid-lipid-associated prot... 67 2e-11 ONK56315.1 uncharacterized protein A4U43_C10F6730 [Asparagus off... 67 2e-11 XP_006838194.1 PREDICTED: probable plastid-lipid-associated prot... 67 3e-11 >KRH75291.1 hypothetical protein GLYMA_01G076100 [Glycine max] Length = 221 Score = 75.9 bits (185), Expect = 1e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE*VESSLS 192 WFDTVYLDDDLRV KDIRGDYLVV+RASYNWKE +ESS S Sbjct: 181 WFDTVYLDDDLRVVKDIRGDYLVVNRASYNWKECMESSSS 220 >XP_006573219.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Glycine max] KRH75290.1 hypothetical protein GLYMA_01G076100 [Glycine max] Length = 241 Score = 75.9 bits (185), Expect = 1e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE*VESSLS 192 WFDTVYLDDDLRV KDIRGDYLVV+RASYNWKE +ESS S Sbjct: 181 WFDTVYLDDDLRVVKDIRGDYLVVNRASYNWKECMESSSS 220 >XP_014629447.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Glycine max] Length = 244 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE*VESSLS 192 WFDTVYLDDDLRV KDIRGDYLVV+RASYNWKE +ESS S Sbjct: 181 WFDTVYLDDDLRVVKDIRGDYLVVNRASYNWKECMESSSS 220 >KHN42525.1 Putative plastid-lipid-associated protein 11, chloroplastic, partial [Glycine soja] Length = 116 Score = 71.2 bits (173), Expect = 7e-14 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVV+RASYNWKE Sbjct: 84 WFDTVYLDDDLRVVKDIRGDYLVVNRASYNWKE 116 >XP_013448320.1 plastid lipid-associated protein [Medicago truncatula] KEH22347.1 plastid lipid-associated protein [Medicago truncatula] Length = 200 Score = 73.2 bits (178), Expect = 8e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRASYNWKE Sbjct: 168 WFDTVYLDDDLRVVKDIRGDYLVVDRASYNWKE 200 >XP_017419220.1 PREDICTED: probable plastid-lipid-associated protein 11 [Vigna angularis] BAT84693.1 hypothetical protein VIGAN_04213000 [Vigna angularis var. angularis] Length = 211 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRASYNWKE Sbjct: 179 WFDTVYLDDDLRVVKDIRGDYLVVDRASYNWKE 211 >XP_014498281.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Vigna radiata var. radiata] Length = 211 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRASYNWKE Sbjct: 179 WFDTVYLDDDLRVVKDIRGDYLVVDRASYNWKE 211 >XP_015971671.1 PREDICTED: probable plastid-lipid-associated protein 11 [Arachis duranensis] XP_016162616.1 PREDICTED: probable plastid-lipid-associated protein 11 [Arachis ipaensis] Length = 217 Score = 71.6 bits (174), Expect = 4e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLD DLRVAKDIRGDYLVVDRASYNWKE Sbjct: 185 WFDTVYLDRDLRVAKDIRGDYLVVDRASYNWKE 217 >XP_004514232.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Cicer arietinum] Length = 214 Score = 71.2 bits (173), Expect = 5e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRASY+WKE Sbjct: 182 WFDTVYLDDDLRVVKDIRGDYLVVDRASYSWKE 214 >XP_007140979.1 hypothetical protein PHAVU_008G157000g [Phaseolus vulgaris] ESW12973.1 hypothetical protein PHAVU_008G157000g [Phaseolus vulgaris] Length = 209 Score = 70.9 bits (172), Expect = 7e-13 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRASY WKE Sbjct: 177 WFDTVYLDDDLRVVKDIRGDYLVVDRASYEWKE 209 >XP_019462226.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Lupinus angustifolius] XP_019462227.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Lupinus angustifolius] OIW01087.1 hypothetical protein TanjilG_25195 [Lupinus angustifolius] Length = 214 Score = 70.9 bits (172), Expect = 8e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WF+TVYLDDDLRVAKDIRGDYLVVDRASY WKE Sbjct: 182 WFETVYLDDDLRVAKDIRGDYLVVDRASYRWKE 214 >KYP54480.1 hypothetical protein KK1_000668 [Cajanus cajan] Length = 198 Score = 70.1 bits (170), Expect = 1e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDDDLRV KDIRGDYLVVDRA+Y+WKE Sbjct: 166 WFDTVYLDDDLRVVKDIRGDYLVVDRATYSWKE 198 >XP_014498282.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Vigna radiata var. radiata] Length = 189 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 308 FDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 FDTVYLDDDLRV KDIRGDYLVVDRASYNWKE Sbjct: 158 FDTVYLDDDLRVVKDIRGDYLVVDRASYNWKE 189 >XP_003538066.1 PREDICTED: probable plastid-lipid-associated protein 11 [Glycine max] KRG88949.1 hypothetical protein GLYMA_U015600 [Glycine max] Length = 209 Score = 68.9 bits (167), Expect = 4e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFD VYLDDDLRV KDIRGDYLVVDRASY+WKE Sbjct: 177 WFDIVYLDDDLRVVKDIRGDYLVVDRASYDWKE 209 >XP_009411573.1 PREDICTED: probable plastid-lipid-associated protein 11 [Musa acuminata subsp. malaccensis] Length = 217 Score = 68.2 bits (165), Expect = 8e-12 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WF+++YLDDD+RVAKDIRGDYL+VDRASY+WKE Sbjct: 185 WFESIYLDDDIRVAKDIRGDYLIVDRASYSWKE 217 >XP_019188928.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] XP_019188929.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] XP_019188931.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X1 [Ipomoea nil] Length = 212 Score = 67.4 bits (163), Expect = 2e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFDTVYLDD++RV KDIRGDYLVV+RA YNWKE Sbjct: 180 WFDTVYLDDEIRVVKDIRGDYLVVERAPYNWKE 212 >KVH88245.1 Plastid lipid-associated protein/fibrillin conserved domain-containing protein [Cynara cardunculus var. scolymus] Length = 214 Score = 67.4 bits (163), Expect = 2e-11 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WFD+VYLDD++R+AKDIRGDYL+VDRASY WKE Sbjct: 182 WFDSVYLDDNIRIAKDIRGDYLIVDRASYQWKE 214 >XP_019462229.1 PREDICTED: probable plastid-lipid-associated protein 11 isoform X2 [Lupinus angustifolius] Length = 192 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 308 FDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 F+TVYLDDDLRVAKDIRGDYLVVDRASY WKE Sbjct: 161 FETVYLDDDLRVAKDIRGDYLVVDRASYRWKE 192 >ONK56315.1 uncharacterized protein A4U43_C10F6730 [Asparagus officinalis] Length = 220 Score = 67.0 bits (162), Expect = 2e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WF++VYLDDD+RVAKDIRGDYLVVDRA Y+WKE Sbjct: 188 WFESVYLDDDIRVAKDIRGDYLVVDRAPYSWKE 220 >XP_006838194.1 PREDICTED: probable plastid-lipid-associated protein 11 [Amborella trichopoda] ERN00763.1 hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] Length = 226 Score = 67.0 bits (162), Expect = 3e-11 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 311 WFDTVYLDDDLRVAKDIRGDYLVVDRASYNWKE 213 WF+++YLDDD+RV KDIRGDYLVVDRA YNWKE Sbjct: 194 WFESIYLDDDIRVVKDIRGDYLVVDRAPYNWKE 226