BLASTX nr result
ID: Glycyrrhiza35_contig00033720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033720 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFL68984.1 multiple antibiotic resistance protein [Methylobacter... 110 3e-28 WP_056238146.1 hypothetical protein [Methylobacterium sp. Leaf45... 110 6e-28 WP_017485780.1 membrane protein [Methylobacterium sp. MB200] 104 1e-25 BAU91271.1 multiple antibiotic resistance-like protein [Methylob... 103 3e-25 WP_012454329.1 membrane protein [Methylobacterium populi] ACB805... 100 2e-24 WP_060769960.1 hypothetical protein [Methylobacterium sp. AMS5] ... 98 2e-23 WP_056504708.1 hypothetical protein [Methylobacterium sp. Leaf12... 98 3e-23 WP_015951055.1 membrane protein [Methylobacterium extorquens] AC... 98 3e-23 WP_003598071.1 MULTISPECIES: membrane protein [Methylobacterium]... 98 3e-23 WP_056460551.1 hypothetical protein [Methylobacterium sp. Leaf90... 98 3e-23 WP_056192647.1 hypothetical protein [Methylobacterium sp. Leaf12... 96 1e-22 WP_056485401.1 hypothetical protein [Methylobacterium sp. Leaf11... 94 1e-21 WP_056495212.1 hypothetical protein [Methylobacterium sp. Leaf11... 94 1e-21 WP_056471974.1 hypothetical protein [Methylobacterium sp. Leaf10... 94 1e-21 WP_056426902.1 MULTISPECIES: hypothetical protein [Methylobacter... 94 1e-21 WP_056276559.1 MULTISPECIES: hypothetical protein [Methylobacter... 94 2e-21 WP_056218209.1 hypothetical protein [Methylobacterium sp. Leaf94... 94 2e-21 WP_056351685.1 hypothetical protein [Methylobacterium sp. Leaf89... 94 2e-21 WP_055946224.1 hypothetical protein [Methylobacterium sp. Leaf12... 94 2e-21 WP_056281018.1 hypothetical protein [Methylobacterium sp. Leaf10... 92 4e-21 >SFL68984.1 multiple antibiotic resistance protein [Methylobacterium salsuginis] Length = 235 Score = 110 bits (276), Expect = 3e-28 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNG++DVLGPLIAAAH+ Sbjct: 177 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGISDVLGPLIAAAHK 234 >WP_056238146.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT61629.1 hypothetical protein ASG52_01740 [Methylobacterium sp. Leaf456] Length = 235 Score = 110 bits (274), Expect = 6e-28 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 GM+RLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNG+ DVLGPLIAAAH+ Sbjct: 177 GMIRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGIADVLGPLIAAAHK 234 >WP_017485780.1 membrane protein [Methylobacterium sp. MB200] Length = 229 Score = 104 bits (259), Expect = 1e-25 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 GM+RLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGV+DVLGPLIA+ Sbjct: 172 GMIRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVSDVLGPLIAS 226 >BAU91271.1 multiple antibiotic resistance-like protein [Methylobacterium populi] Length = 229 Score = 103 bits (256), Expect = 3e-25 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 GM+R+AYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGV+DVLGPLIA+ Sbjct: 172 GMIRVAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVSDVLGPLIAS 226 >WP_012454329.1 membrane protein [Methylobacterium populi] ACB80598.1 multiple antibiotic resistance (MarC)-related protein [Methylobacterium populi BJ001] OAH33354.1 hypothetical protein AX289_00415 [Methylobacterium populi] Length = 229 Score = 100 bits (250), Expect = 2e-24 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 172 GVIRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 226 >WP_060769960.1 hypothetical protein [Methylobacterium sp. AMS5] AMB45621.1 membrane protein [Methylobacterium sp. AMS5] Length = 229 Score = 98.2 bits (243), Expect = 2e-23 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 G++RLAYGSADRVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLI A+HR Sbjct: 172 GVIRLAYGSADRVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLI-ASHR 228 >WP_056504708.1 hypothetical protein [Methylobacterium sp. Leaf121] KQP99127.1 hypothetical protein ASF59_06650 [Methylobacterium sp. Leaf121] Length = 229 Score = 97.8 bits (242), Expect = 3e-23 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSADRVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 172 GVIRLAYGSADRVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 226 >WP_015951055.1 membrane protein [Methylobacterium extorquens] ACK83570.1 multiple antibiotic resistance (MarC)-related protein [Methylobacterium extorquens CM4] APX87002.1 hypothetical protein BV511_21210 [Methylobacterium extorquens] Length = 231 Score = 97.8 bits (242), Expect = 3e-23 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSADRVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 174 GVIRLAYGSADRVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 228 >WP_003598071.1 MULTISPECIES: membrane protein [Methylobacterium] ABY30903.1 multiple antibiotic resistance (MarC)-related protein [Methylobacterium extorquens PA1] ACS40253.1 putative multiple antibiotic resistance protein, MarC family transport protein [Methylobacterium extorquens AM1] CAX24888.1 putative multiple antibiotic resistance protein, MarC family transport protein [Methylobacterium extorquens DM4] EHP93783.1 multiple antibiotic resistance (MarC)-related protein [Methylobacterium extorquens DSM 13060] KQO94954.1 hypothetical protein ASF33_11920 [Methylobacterium sp. Leaf92] KQP87626.1 hypothetical protein ASF55_07335 [Methylobacterium sp. Leaf119] KQQ00177.1 hypothetical protein ASF56_14845 [Methylobacterium sp. Leaf122] OHV16338.1 hypothetical protein BK022_12780 [Methylobacterium extorquens] Length = 231 Score = 97.8 bits (242), Expect = 3e-23 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSADRVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 174 GVIRLAYGSADRVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 228 >WP_056460551.1 hypothetical protein [Methylobacterium sp. Leaf90] KQO86716.1 hypothetical protein ASF36_04775 [Methylobacterium sp. Leaf90] Length = 231 Score = 97.8 bits (242), Expect = 3e-23 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSADRVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 174 GVIRLAYGSADRVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 228 >WP_056192647.1 hypothetical protein [Methylobacterium sp. Leaf123] KQQ31387.1 hypothetical protein ASF53_01380 [Methylobacterium sp. Leaf123] Length = 229 Score = 96.3 bits (238), Expect = 1e-22 Identities = 48/55 (87%), Positives = 54/55 (98%) Frame = -1 Query: 286 GMVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAA 122 G++RLAYGSA+RVVTLIG VRARVLGRLSAFLLLCVGTQITV+GV+DVLGPLIA+ Sbjct: 172 GVIRLAYGSAERVVTLIGSVRARVLGRLSAFLLLCVGTQITVSGVSDVLGPLIAS 226 >WP_056485401.1 hypothetical protein [Methylobacterium sp. Leaf117] KQP82997.1 hypothetical protein ASF57_12845 [Methylobacterium sp. Leaf117] Length = 229 Score = 93.6 bits (231), Expect = 1e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 173 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 229 >WP_056495212.1 hypothetical protein [Methylobacterium sp. Leaf111] KQP59763.1 hypothetical protein ASF41_08485 [Methylobacterium sp. Leaf111] Length = 229 Score = 93.6 bits (231), Expect = 1e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 173 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 229 >WP_056471974.1 hypothetical protein [Methylobacterium sp. Leaf104] KQP38401.1 hypothetical protein ASF49_05215 [Methylobacterium sp. Leaf104] Length = 229 Score = 93.6 bits (231), Expect = 1e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 173 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 229 >WP_056426902.1 MULTISPECIES: hypothetical protein [Methylobacterium] KQO48952.1 hypothetical protein ASF24_07010 [Methylobacterium sp. Leaf86] KQO94360.1 hypothetical protein ASF32_19685 [Methylobacterium sp. Leaf91] Length = 229 Score = 93.6 bits (231), Expect = 1e-21 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLC+GTQITVNGVTDVLGP++AA R Sbjct: 173 LVRFTYGSADRVVTAIGPVGARVLGRLFAFLLLCIGTQITVNGVTDVLGPILAAGKR 229 >WP_056276559.1 MULTISPECIES: hypothetical protein [Methylobacterium] KQO65679.1 hypothetical protein ASF20_07285 [Methylobacterium sp. Leaf88] KQT73448.1 hypothetical protein ASG51_08065 [Methylobacterium sp. Leaf465] Length = 237 Score = 93.6 bits (231), Expect = 2e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 181 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 237 >WP_056218209.1 hypothetical protein [Methylobacterium sp. Leaf94] KQU20989.1 hypothetical protein ASG63_04960 [Methylobacterium sp. Leaf94] Length = 241 Score = 93.6 bits (231), Expect = 2e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 185 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 241 >WP_056351685.1 hypothetical protein [Methylobacterium sp. Leaf89] KQO67676.1 hypothetical protein ASF18_03905 [Methylobacterium sp. Leaf89] Length = 241 Score = 93.6 bits (231), Expect = 2e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 185 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 241 >WP_055946224.1 hypothetical protein [Methylobacterium sp. Leaf125] KQQ47947.1 hypothetical protein ASF58_00865 [Methylobacterium sp. Leaf125] Length = 245 Score = 93.6 bits (231), Expect = 2e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIAAAHR 113 +VR YGSADRVVT IGPV ARVLGRL AFLLLCVGTQITVNGVTDVLGPL+A A R Sbjct: 189 LVRFTYGSADRVVTWIGPVGARVLGRLFAFLLLCVGTQITVNGVTDVLGPLLAQAGR 245 >WP_056281018.1 hypothetical protein [Methylobacterium sp. Leaf108] KQP61726.1 hypothetical protein ASF39_03410 [Methylobacterium sp. Leaf108] Length = 228 Score = 92.4 bits (228), Expect = 4e-21 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -1 Query: 283 MVRLAYGSADRVVTLIGPVRARVLGRLSAFLLLCVGTQITVNGVTDVLGPLIA 125 MVR+AYGSADRVV+LIGP RARVLGRLSAFLLLCVGTQI +NGV DVLGPL+A Sbjct: 172 MVRIAYGSADRVVSLIGPGRARVLGRLSAFLLLCVGTQIFLNGVVDVLGPLVA 224