BLASTX nr result
ID: Glycyrrhiza35_contig00033555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033555 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572571.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 4e-26 GAU31832.1 hypothetical protein TSUD_58330 [Trifolium subterraneum] 97 6e-22 XP_013456890.1 PPR containing plant-like protein [Medicago trunc... 96 2e-21 XP_003608051.2 PPR containing plant-like protein [Medicago trunc... 96 2e-21 XP_014506231.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 2e-19 XP_003528496.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 5e-19 OIV93262.1 hypothetical protein TanjilG_23103 [Lupinus angustifo... 86 4e-18 XP_019424236.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 4e-18 XP_017425525.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 2e-17 KOM31832.1 hypothetical protein LR48_Vigan01g138800 [Vigna angul... 84 2e-17 XP_007156522.1 hypothetical protein PHAVU_003G293100g [Phaseolus... 84 3e-17 XP_019422727.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 1e-16 OIV93245.1 hypothetical protein TanjilG_27424 [Lupinus angustifo... 82 2e-16 KYP49821.1 Pentatricopeptide repeat-containing protein At4g02750... 81 2e-16 XP_016182089.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 2e-15 XP_015944423.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-14 KRH71204.1 hypothetical protein GLYMA_02G136600 [Glycine max] 72 3e-13 XP_016190641.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-13 XP_015957583.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-13 XP_018809727.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-08 >XP_012572571.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Cicer arietinum] Length = 278 Score = 105 bits (261), Expect = 4e-26 Identities = 49/68 (72%), Positives = 54/68 (79%) Frame = -2 Query: 206 FCPAHNSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLR 27 FCP WKR++ +LFTTLLQA EPH +H+ S NISIAH AKTG LKEA H FDEMPLR Sbjct: 7 FCPVSTIWKRKQKLQLFTTLLQASEPHPSHVISTNISIAHLAKTGKLKEARHKFDEMPLR 66 Query: 26 TISSWNTM 3 TISSWNTM Sbjct: 67 TISSWNTM 74 >GAU31832.1 hypothetical protein TSUD_58330 [Trifolium subterraneum] Length = 723 Score = 97.1 bits (240), Expect = 6e-22 Identities = 44/68 (64%), Positives = 52/68 (76%) Frame = -2 Query: 206 FCPAHNSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLR 27 FCP +WKR++ +LFTTLLQ EPH H+ S NISIAH AK G L+EA HMFDEMP+R Sbjct: 7 FCPLSITWKRKQKLQLFTTLLQESEPHPPHVISTNISIAHCAKLGKLEEARHMFDEMPMR 66 Query: 26 TISSWNTM 3 T+ SWNTM Sbjct: 67 TVCSWNTM 74 >XP_013456890.1 PPR containing plant-like protein [Medicago truncatula] KEH30921.1 PPR containing plant-like protein [Medicago truncatula] Length = 576 Score = 95.5 bits (236), Expect = 2e-21 Identities = 43/68 (63%), Positives = 52/68 (76%) Frame = -2 Query: 206 FCPAHNSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLR 27 F P +WKR++ + FTTLL+A +P+ H+ S NISIAH AKTG L EA HMFDEMPLR Sbjct: 7 FSPVSTTWKRKQKLQFFTTLLEASQPYPPHVISTNISIAHHAKTGKLVEARHMFDEMPLR 66 Query: 26 TISSWNTM 3 T+SSWNTM Sbjct: 67 TVSSWNTM 74 >XP_003608051.2 PPR containing plant-like protein [Medicago truncatula] AES90248.2 PPR containing plant-like protein [Medicago truncatula] Length = 724 Score = 95.5 bits (236), Expect = 2e-21 Identities = 43/68 (63%), Positives = 52/68 (76%) Frame = -2 Query: 206 FCPAHNSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLR 27 F P +WKR++ + FTTLL+A +P+ H+ S NISIAH AKTG L EA HMFDEMPLR Sbjct: 7 FSPVSTTWKRKQKLQFFTTLLEASQPYPPHVISTNISIAHHAKTGKLVEARHMFDEMPLR 66 Query: 26 TISSWNTM 3 T+SSWNTM Sbjct: 67 TVSSWNTM 74 >XP_014506231.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vigna radiata var. radiata] Length = 728 Score = 89.7 bits (221), Expect = 2e-19 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = -2 Query: 185 WKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSWNT 6 WKR+E+FRLFTT LQ+ EPH ++ S NISIA R K G+L+EA H+FD+MP RT+SSWNT Sbjct: 18 WKRKESFRLFTTQLQSSEPHVGYVISTNISIAQRFKMGNLEEARHLFDQMPQRTVSSWNT 77 Query: 5 M 3 M Sbjct: 78 M 78 >XP_003528496.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] KHN31042.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH50225.1 hypothetical protein GLYMA_07G208800 [Glycine max] Length = 728 Score = 88.6 bits (218), Expect = 5e-19 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WKR E FRLFTT LQ EPH ++ S NISIA R K G L+EA H+FD+MP RT+SSW Sbjct: 16 NRWKRNERFRLFTTHLQTTEPHVGNVISTNISIAQRFKMGKLEEARHLFDQMPNRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >OIV93262.1 hypothetical protein TanjilG_23103 [Lupinus angustifolius] Length = 726 Score = 86.3 bits (212), Expect = 4e-18 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK+++ FRLFTTLL + EPH + NISIA A +G L++A H+FDEMPLRT+SSW Sbjct: 14 NRWKQKQRFRLFTTLLHSSEPHLLQVIPTNISIAKLANSGQLEQARHLFDEMPLRTVSSW 73 Query: 11 NTM 3 NTM Sbjct: 74 NTM 76 >XP_019424236.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Lupinus angustifolius] Length = 730 Score = 86.3 bits (212), Expect = 4e-18 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK+++ FRLFTTLL + EPH + NISIA A +G L++A H+FDEMPLRT+SSW Sbjct: 14 NRWKQKQRFRLFTTLLHSSEPHLLQVIPTNISIAKLANSGQLEQARHLFDEMPLRTVSSW 73 Query: 11 NTM 3 NTM Sbjct: 74 NTM 76 >XP_017425525.1 PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Vigna angularis] BAT75059.1 hypothetical protein VIGAN_01286000 [Vigna angularis var. angularis] Length = 728 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WKR+E FRLFTT LQ+ E H ++ S NISIA R K G+L+EA H+FD+M RT+SSW Sbjct: 16 NRWKRKERFRLFTTQLQSSEHHIDYVISTNISIAQRFKMGNLEEARHLFDQMRQRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >KOM31832.1 hypothetical protein LR48_Vigan01g138800 [Vigna angularis] Length = 755 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WKR+E FRLFTT LQ+ E H ++ S NISIA R K G+L+EA H+FD+M RT+SSW Sbjct: 16 NRWKRKERFRLFTTQLQSSEHHIDYVISTNISIAQRFKMGNLEEARHLFDQMRQRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >XP_007156522.1 hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] ESW28516.1 hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] Length = 728 Score = 83.6 bits (205), Expect = 3e-17 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK + FRLFTT LQA EPH + S NISIA R G+L+EA H+FD+MP RT+SSW Sbjct: 16 NRWKWNQRFRLFTTQLQASEPHVGFVISTNISIAKRFNMGNLEEARHLFDQMPHRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >XP_019422727.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Lupinus angustifolius] Length = 728 Score = 81.6 bits (200), Expect = 1e-16 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK ++ R FTTLL + EPHF + ANISIA A G L++A ++FDEMPLRT+SSW Sbjct: 16 NRWKWKQRLRTFTTLLHSSEPHFPQIIPANISIAKLANAGQLEQARYLFDEMPLRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >OIV93245.1 hypothetical protein TanjilG_27424 [Lupinus angustifolius] Length = 793 Score = 81.6 bits (200), Expect = 2e-16 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK ++ R FTTLL + EPHF + ANISIA A G L++A ++FDEMPLRT+SSW Sbjct: 16 NRWKWKQRLRTFTTLLHSSEPHFPQIIPANISIAKLANAGQLEQARYLFDEMPLRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >KYP49821.1 Pentatricopeptide repeat-containing protein At4g02750 family [Cajanus cajan] Length = 431 Score = 81.3 bits (199), Expect = 2e-16 Identities = 38/63 (60%), Positives = 46/63 (73%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISSW 12 N WK +E FRLFTT LQA +PH + S NIS+A R K G L+EA H+FD+M RT+SSW Sbjct: 16 NRWKLKERFRLFTTHLQAPDPHVGKVISINISLAQRFKMGKLEEARHLFDQMAHRTVSSW 75 Query: 11 NTM 3 NTM Sbjct: 76 NTM 78 >XP_016182089.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182090.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182091.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182092.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182093.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] Length = 726 Score = 78.2 bits (191), Expect = 2e-15 Identities = 38/64 (59%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALE-PHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISS 15 N WK+R FRLFTTLL+ L+ P H+ + NISI R K+G+L+ A H+FDEMPLRT+S+ Sbjct: 13 NRWKQR--FRLFTTLLEDLDTPRLRHVIATNISIGRRVKSGELELARHLFDEMPLRTVST 70 Query: 14 WNTM 3 WNTM Sbjct: 71 WNTM 74 >XP_015944423.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] XP_015944424.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] XP_015944425.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] Length = 726 Score = 75.5 bits (184), Expect = 2e-14 Identities = 37/64 (57%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEP-HFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISS 15 N WK+R FRLFTTLL+ L+ H+ + NISI+ R K+G+L+ A H+FDEMPLRT+S+ Sbjct: 13 NRWKQR--FRLFTTLLEDLDTARLRHVIATNISISRRVKSGELELARHLFDEMPLRTVST 70 Query: 14 WNTM 3 WNTM Sbjct: 71 WNTM 74 >KRH71204.1 hypothetical protein GLYMA_02G136600 [Glycine max] Length = 608 Score = 72.4 bits (176), Expect = 3e-13 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTIS 18 N WKR + FRLFTT LQA E H+ S NISIA R K G+++EAH +FD+MP RT+S Sbjct: 20 NCWKRNQRFRLFTTHLQASESDVGHVISTNISIARRFKIGNVEEAHRLFDQMPHRTVS 77 >XP_016190641.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190643.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190644.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190645.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190646.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] Length = 716 Score = 72.4 bits (176), Expect = 3e-13 Identities = 35/64 (54%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALE-PHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISS 15 N WK+R FRLFTTLL+ L+ P H+ + NISI+ R + G+ + A H+FD+MPLRT+S+ Sbjct: 13 NCWKQR--FRLFTTLLEDLDTPRLRHVIATNISISRRVRYGEPELARHLFDDMPLRTVST 70 Query: 14 WNTM 3 WNTM Sbjct: 71 WNTM 74 >XP_015957583.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis duranensis] XP_015957584.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis duranensis] Length = 725 Score = 72.4 bits (176), Expect = 3e-13 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -2 Query: 191 NSWKRRENFRLFTTLLQALE-PHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISS 15 N WK+R FRLFTTLL+ L+ P H+ + NISI+ R K+G + A H+FD+MPLRT+S+ Sbjct: 13 NCWKQR--FRLFTTLLEDLDTPCLRHVIATNISISRRVKSGKPELARHLFDDMPLRTVST 70 Query: 14 WNTM 3 WNTM Sbjct: 71 WNTM 74 >XP_018809727.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Juglans regia] Length = 713 Score = 58.2 bits (139), Expect = 3e-08 Identities = 32/64 (50%), Positives = 39/64 (60%) Frame = -2 Query: 194 HNSWKRRENFRLFTTLLQALEPHFAHMNSANISIAHRAKTGDLKEAHHMFDEMPLRTISS 15 H+ WK+ F+ FTTL Q L+ + S NIS+A K G L A MFDEMP RT+ S Sbjct: 13 HSRWKKI--FQPFTTLYQPLQATRNLIVSTNISVAELCKIGQLDIARKMFDEMPERTVVS 70 Query: 14 WNTM 3 WNTM Sbjct: 71 WNTM 74