BLASTX nr result
ID: Glycyrrhiza35_contig00033499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033499 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013463320.1 type II superfamily restriction endonuclease [Med... 64 3e-10 XP_003597037.1 type II superfamily restriction endonuclease [Med... 62 8e-10 >XP_013463320.1 type II superfamily restriction endonuclease [Medicago truncatula] KEH37331.1 type II superfamily restriction endonuclease [Medicago truncatula] Length = 344 Score = 63.5 bits (153), Expect = 3e-10 Identities = 37/67 (55%), Positives = 39/67 (58%) Frame = -3 Query: 203 NVHRSTLHIHPYQLHHLCGEIASSFSVVLPQHFKHRSSCYMGAPVALLGNKRNCSSYPGS 24 NV RSTLH C +I SS SV QHFKH SS Y GA VA L NKR SS S Sbjct: 15 NVRRSTLH---------CDKIGSSLSVACVQHFKHESSYYKGALVACLSNKRIFSSNASS 65 Query: 23 HAQNNPS 3 HA +NPS Sbjct: 66 HAPDNPS 72 >XP_003597037.1 type II superfamily restriction endonuclease [Medicago truncatula] AES67288.1 type II superfamily restriction endonuclease [Medicago truncatula] Length = 344 Score = 62.4 bits (150), Expect = 8e-10 Identities = 37/67 (55%), Positives = 39/67 (58%) Frame = -3 Query: 203 NVHRSTLHIHPYQLHHLCGEIASSFSVVLPQHFKHRSSCYMGAPVALLGNKRNCSSYPGS 24 NV RSTLH C +I SS SV QHFKH SS Y GA VA L NKR SS S Sbjct: 15 NVRRSTLH---------CDKIGSSLSVARVQHFKHGSSYYKGALVACLSNKRIFSSNASS 65 Query: 23 HAQNNPS 3 HA +NPS Sbjct: 66 HAPDNPS 72