BLASTX nr result
ID: Glycyrrhiza35_contig00033347
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033347 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), p... 54 2e-07 XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [M... 47 4e-06 >XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89895.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1157 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 7/55 (12%) Frame = +1 Query: 124 EVQVMNCGYRWVFKEDLQ-----MLHCENLFAQRREFLAIED*AQ--LLIKSDYC 267 +V+V NCGYRWV+K DLQ M+HC++ AQ + L IED AQ LL+ +C Sbjct: 1037 DVEVKNCGYRWVYKHDLQHLNFTMMHCKSSLAQNCDILGIEDEAQPELLLYESFC 1091 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 2 SNHIWPIYFPREVFFHVLEN-ERRRGDHNIKMSACISQG 115 SNHIW YF RE F ++ + + GD I+M I G Sbjct: 997 SNHIWLAYFTRESFIDLMSDIDSTLGD--IRMEVLIVDG 1033 >XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89794.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1054 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 5/41 (12%) Frame = +1 Query: 127 VQVMNCGYRWVFKEDLQ-----MLHCENLFAQRREFLAIED 234 V V CGYR+VFK+DL+ ++H N FAQ+R+FLAIED Sbjct: 1014 VDVKTCGYRYVFKQDLKQFNSTVMHHRNPFAQKRKFLAIED 1054 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 2 SNHIWPIYFPREVFFHVLENERRRGDHNIKMSACISQG 115 SNH W IY PR+ + +N+ + +I M+AC+ G Sbjct: 974 SNHTWLIYVPRDSLSY--QNKAFKDVDHITMTACLEDG 1009