BLASTX nr result
ID: Glycyrrhiza35_contig00033335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033335 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003592373.2 Pti1-like kinase [Medicago truncatula] AES62624.2... 55 4e-07 XP_004496638.1 PREDICTED: PTI1-like tyrosine-protein kinase At3g... 53 3e-06 >XP_003592373.2 Pti1-like kinase [Medicago truncatula] AES62624.2 Pti1-like kinase [Medicago truncatula] Length = 369 Score = 55.1 bits (131), Expect = 4e-07 Identities = 25/31 (80%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +3 Query: 129 MHLKCLCCFLSEEEQNQRRNVDDKKN-RDYP 218 M LKCLCCFLS EEQ+ +RNVDDKKN RDYP Sbjct: 1 MPLKCLCCFLSNEEQSHKRNVDDKKNIRDYP 31 >XP_004496638.1 PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Cicer arietinum] Length = 367 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/31 (77%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +3 Query: 129 MHLKCLCCFLSEEEQNQRRNVDDKKN-RDYP 218 M LKCLCCF E+EQ RRNVDDKKN RDYP Sbjct: 1 MSLKCLCCFSKEKEQRHRRNVDDKKNIRDYP 31