BLASTX nr result
ID: Glycyrrhiza35_contig00033284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033284 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076858547.1 transglutaminase [Bradyrhizobium sp. SEMIA 6399] 115 2e-30 SEC41481.1 Predicted transglutaminase-like cysteine proteinase [... 115 2e-30 WP_050406412.1 transglutaminase [Bradyrhizobium embrapense] 115 2e-30 WP_050625578.1 transglutaminase [Bradyrhizobium viridifuturi] 115 2e-30 WP_024582472.1 MULTISPECIES: transglutaminase [Bradyrhizobium] K... 115 2e-30 ERF85967.1 penicillin-insensitive murein endopeptidase [Bradyrhi... 115 2e-30 WP_029081517.1 transglutaminase [Bradyrhizobium sp. th.b2] 114 6e-30 WP_044585897.1 transglutaminase [Bradyrhizobium sp. LTSPM299] KJ... 114 8e-30 WP_044541297.1 transglutaminase [Bradyrhizobium sp. LTSP885] KJC... 114 8e-30 WP_074275351.1 transglutaminase [Bradyrhizobium erythrophlei] SI... 114 8e-30 SDN18676.1 Predicted transglutaminase-like cysteine proteinase [... 114 9e-30 WP_074815048.1 transglutaminase [Bradyrhizobium lablabi] SDJ8930... 114 9e-30 WP_069279885.1 transglutaminase [Bradyrhizobium elkanii] ODM7165... 112 2e-29 WP_028342941.1 transglutaminase [Bradyrhizobium elkanii] 112 2e-29 WP_026192955.1 MULTISPECIES: transglutaminase [Bradyrhizobium] K... 112 2e-29 WP_027584563.1 transglutaminase [Bradyrhizobium sp. Ai1a-2] 112 2e-29 WP_027539233.1 transglutaminase [Bradyrhizobium sp. URHA0002] 112 5e-29 CCD97083.1 conserved exported hypothetical protein [Bradyrhizobi... 111 5e-29 WP_066510930.1 transglutaminase [Bradyrhizobium sp. BR 10303] KW... 111 6e-29 SHH61243.1 Predicted transglutaminase-like cysteine proteinase [... 111 7e-29 >WP_076858547.1 transglutaminase [Bradyrhizobium sp. SEMIA 6399] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >SEC41481.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium erythrophlei] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_050406412.1 transglutaminase [Bradyrhizobium embrapense] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_050625578.1 transglutaminase [Bradyrhizobium viridifuturi] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_024582472.1 MULTISPECIES: transglutaminase [Bradyrhizobium] KIU43436.1 transglutaminase [Bradyrhizobium elkanii] OCX28666.1 transglutaminase [Bradyrhizobium sp. UASWS1016] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >ERF85967.1 penicillin-insensitive murein endopeptidase [Bradyrhizobium sp. DFCI-1] Length = 204 Score = 115 bits (288), Expect = 2e-30 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_029081517.1 transglutaminase [Bradyrhizobium sp. th.b2] Length = 204 Score = 114 bits (285), Expect = 6e-30 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWT+TGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTDTGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_044585897.1 transglutaminase [Bradyrhizobium sp. LTSPM299] KJC62326.1 transglutaminase [Bradyrhizobium sp. LTSPM299] Length = 204 Score = 114 bits (284), Expect = 8e-30 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_044541297.1 transglutaminase [Bradyrhizobium sp. LTSP885] KJC38021.1 transglutaminase [Bradyrhizobium sp. LTSP885] Length = 204 Score = 114 bits (284), Expect = 8e-30 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 196 >WP_074275351.1 transglutaminase [Bradyrhizobium erythrophlei] SIO46884.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium erythrophlei] Length = 207 Score = 114 bits (284), Expect = 8e-30 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 146 EGHAVLTVKTDKGEFVLDNQNETVVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 199 >SDN18676.1 Predicted transglutaminase-like cysteine proteinase [Afipia sp. GAS231] Length = 209 Score = 114 bits (284), Expect = 9e-30 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 146 EGHAVLTVKTDKGEFVLDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 199 >WP_074815048.1 transglutaminase [Bradyrhizobium lablabi] SDJ89303.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium ottawaense] SEC02253.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium lablabi] SHM68827.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium lablabi] Length = 209 Score = 114 bits (284), Expect = 9e-30 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGDNRP Sbjct: 146 EGHAVLTVKTDKGEFVLDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 199 >WP_069279885.1 transglutaminase [Bradyrhizobium elkanii] ODM71655.1 transglutaminase [Bradyrhizobium elkanii] ODM79027.1 transglutaminase [Bradyrhizobium elkanii] Length = 204 Score = 112 bits (281), Expect = 2e-29 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWT+TGYRFVKRQSQ DPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTDTGYRFVKRQSQGDPNVWVSLGDNRP 196 >WP_028342941.1 transglutaminase [Bradyrhizobium elkanii] Length = 204 Score = 112 bits (281), Expect = 2e-29 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWT+TGYRFVKRQSQ DPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTDTGYRFVKRQSQGDPNVWVSLGDNRP 196 >WP_026192955.1 MULTISPECIES: transglutaminase [Bradyrhizobium] KRP89547.1 transglutaminase [Bradyrhizobium pachyrhizi] SDF93907.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium sp. R5] OIM92554.1 transglutaminase [Bradyrhizobium elkanii] OMI05682.1 transglutaminase [Bradyrhizobium sp. UFLA 03-321] Length = 204 Score = 112 bits (281), Expect = 2e-29 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNESIVAWT+TGYRFVKRQSQ DPNVWVSLGDNRP Sbjct: 143 EGHAVLTVKTDKGEFVLDNQNESIVAWTDTGYRFVKRQSQGDPNVWVSLGDNRP 196 >WP_027584563.1 transglutaminase [Bradyrhizobium sp. Ai1a-2] Length = 208 Score = 112 bits (281), Expect = 2e-29 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEF+LDNQNE +VAWTETGYRFVKRQSQSDPN+WVSLGDNRP Sbjct: 146 EGHAVLTVKTDKGEFILDNQNEDVVAWTETGYRFVKRQSQSDPNIWVSLGDNRP 199 >WP_027539233.1 transglutaminase [Bradyrhizobium sp. URHA0002] Length = 209 Score = 112 bits (279), Expect = 5e-29 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEFVLDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGD+RP Sbjct: 146 EGHAVLTVKTDKGEFVLDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDSRP 199 >CCD97083.1 conserved exported hypothetical protein [Bradyrhizobium sp. ORS 375] Length = 198 Score = 111 bits (278), Expect = 5e-29 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGE+VLDNQNES+VAWTETGYRFVKRQSQSDPNVWVSLGD RP Sbjct: 135 EGHAVLTVKTDKGEYVLDNQNESVVAWTETGYRFVKRQSQSDPNVWVSLGDGRP 188 >WP_066510930.1 transglutaminase [Bradyrhizobium sp. BR 10303] KWV51465.1 transglutaminase [Bradyrhizobium sp. BR 10303] Length = 204 Score = 111 bits (278), Expect = 6e-29 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNR 161 EGHAVLTVKTDKGE+VLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNR Sbjct: 143 EGHAVLTVKTDKGEYVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNR 195 >SHH61243.1 Predicted transglutaminase-like cysteine proteinase [Bradyrhizobium erythrophlei] Length = 206 Score = 111 bits (278), Expect = 7e-29 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = +3 Query: 3 EGHAVLTVKTDKGEFVLDNQNESIVAWTETGYRFVKRQSQSDPNVWVSLGDNRP 164 EGHAVLTVKTDKGEF+LDNQNE++VAWTETGYRFVKRQSQSDPNVWVSLGD+RP Sbjct: 145 EGHAVLTVKTDKGEFILDNQNENVVAWTETGYRFVKRQSQSDPNVWVSLGDSRP 198