BLASTX nr result
ID: Glycyrrhiza35_contig00033202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033202 (956 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus cl... 95 3e-21 ACU23295.1 unknown [Glycine max] 90 2e-19 XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago trunc... 50 1e-08 XP_003601656.2 rhodanese/cell cycle control phosphatase superfam... 56 2e-07 XP_013461206.1 rhodanese/cell cycle control phosphatase superfam... 56 2e-07 KVI08263.1 hypothetical protein Ccrd_013365 [Cynara cardunculus ... 46 7e-07 >XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] ESR34253.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 95.1 bits (235), Expect = 3e-21 Identities = 46/68 (67%), Positives = 50/68 (73%) Frame = +1 Query: 1 FFSYPGGGNGKQRDIAQNPDMPRVKSLQN*ECFN*FPVALFQKGNEPATKLLSMHHVTTF 180 FFSYPGGGNGKQRDIAQN + + + N FPVALFQ+ NEP T LLSMHHV TF Sbjct: 4 FFSYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTF 63 Query: 181 ISSFNIPP 204 ISSFN PP Sbjct: 64 ISSFNNPP 71 >ACU23295.1 unknown [Glycine max] Length = 60 Score = 89.7 bits (221), Expect = 2e-19 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = -3 Query: 168 MVHGQELSCRFVPFLEQCYWKLIEALSILQGFYPRHIWILCNVALFSISTTRI*KE 1 MVHGQE SC FVPFLEQ YWK+I+A S L+ FY R IWILCNVALFSISTTRI KE Sbjct: 1 MVHGQEHSCWFVPFLEQGYWKIIQAPSNLEEFYTRRIWILCNVALFSISTTRIWKE 56 >XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago truncatula] AET04083.2 hypothetical protein MTR_8g081570 [Medicago truncatula] Length = 583 Score = 50.4 bits (119), Expect(2) = 1e-08 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 62 ISGFCAMSRCFPFPPPGYEK 3 ISGFCAMSRCFPFPPPGYEK Sbjct: 19 ISGFCAMSRCFPFPPPGYEK 38 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 168 MVHGQELSCRFVPFLEQC 115 MVHGQE SC FVPFLEQC Sbjct: 1 MVHGQEHSCWFVPFLEQC 18 >XP_003601656.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] AES71907.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1378 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 71 TLGISGFCAMSRCFPFPPPGYEK 3 TLGISGFCAMSRCFPFPPPGYEK Sbjct: 20 TLGISGFCAMSRCFPFPPPGYEK 42 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 168 MVHGQELSCRFVPFLEQ 118 MVHGQE SC F FLEQ Sbjct: 1 MVHGQENSCWFDLFLEQ 17 >XP_013461206.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] KEH35240.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1330 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 71 TLGISGFCAMSRCFPFPPPGYEK 3 TLGISGFCAMSRCFPFPPPGYEK Sbjct: 20 TLGISGFCAMSRCFPFPPPGYEK 42 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 168 MVHGQELSCRFVPFLEQ 118 MVHGQE SC F FLEQ Sbjct: 1 MVHGQENSCWFDLFLEQ 17 >KVI08263.1 hypothetical protein Ccrd_013365 [Cynara cardunculus var. scolymus] Length = 705 Score = 45.8 bits (107), Expect(2) = 7e-07 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -1 Query: 83 CKDFTLG------ISGFCAMSRCFPFPPPGYEK 3 C+D G + G CAMSRCFPFPPPGYEK Sbjct: 74 CEDMVNGEENISLVRGACAMSRCFPFPPPGYEK 106 Score = 36.6 bits (83), Expect(2) = 7e-07 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -3 Query: 216 VRGPWRNIKAGNECGDMVHGQE 151 +RG W+ I++GNEC DMV+G+E Sbjct: 61 LRGAWKGIESGNECEDMVNGEE 82