BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Glycyrrhiza35_contig00033200
         (227 letters)

Database: ./nr 
           115,041,592 sequences; 42,171,959,267 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela...    65   5e-12

>EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia
           subvermispora B]
          Length = 87

 Score = 64.7 bits (156), Expect = 5e-12
 Identities = 33/67 (49%), Positives = 38/67 (56%)
 Frame = -3

Query: 225 LRQHPKCEGVRRPAQRAHCVPWSGSSYPA*GYNTSGDATFPMRFSDDPNQCWLATEKYTK 46
           LRQHPK E  R P  +A C P S  SY   GYNT   ATFP+ FSDD N+CW    K  +
Sbjct: 17  LRQHPKHERGRTPTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWPVDRKVHQ 76

Query: 45  PKGQAES 25
            K +  S
Sbjct: 77  AKARLSS 83


  Database: ./nr
    Posted date:  Mar 21, 2017 10:06 AM
  Number of letters in database: 42,171,959,267
  Number of sequences in database:  115,041,592
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115041592
Number of Hits to DB: 295,371,558,851,263
Number of extensions: 116844799
Number of successful extensions: -1766006726
Number of sequences better than 1.0e-05: 58692501
Number of HSP's gapped: -1976343205
Number of HSP's successfully gapped: 84574933
Length of database: 42,171,959,267
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)