BLASTX nr result
ID: Glycyrrhiza35_contig00033167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00033167 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH37191.1 hypothetical protein GLYMA_09G050500 [Glycine max] 73 1e-12 KHN26609.1 Pentatricopeptide repeat-containing protein [Glycine ... 73 1e-12 XP_006586943.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 XP_012573735.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 GAU33588.1 hypothetical protein TSUD_359660 [Trifolium subterran... 72 4e-12 XP_007138861.1 hypothetical protein PHAVU_009G243700g [Phaseolus... 71 7e-12 GAU43169.1 hypothetical protein TSUD_301340 [Trifolium subterran... 70 1e-11 GAU43168.1 hypothetical protein TSUD_301350 [Trifolium subterran... 70 1e-11 XP_014498979.1 PREDICTED: uncharacterized protein LOC106760056 [... 69 2e-11 XP_003594857.1 PPR containing plant-like protein [Medicago trunc... 67 1e-10 XP_017408274.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 OIW14265.1 hypothetical protein TanjilG_21405 [Lupinus angustifo... 65 1e-09 XP_019439321.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_016171182.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 9e-09 XP_015937071.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 9e-09 XP_018853395.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_016648698.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 KDP46790.1 hypothetical protein JCGZ_11161 [Jatropha curcas] 57 3e-07 XP_012065087.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 4e-07 XP_017190750.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 >KRH37191.1 hypothetical protein GLYMA_09G050500 [Glycine max] Length = 482 Score = 72.8 bits (177), Expect = 1e-12 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 +HKFLLPKASTWA+VVQQ+CKP+ +RK+IS+CWSRL C Sbjct: 445 MHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 482 >KHN26609.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 556 Score = 72.8 bits (177), Expect = 1e-12 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 +HKFLLPKASTWA+VVQQ+CKP+ +RK+IS+CWSRL C Sbjct: 519 MHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 556 >XP_006586943.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] XP_006586944.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] XP_006586946.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] XP_014617398.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] XP_014617399.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] KRH37190.1 hypothetical protein GLYMA_09G050500 [Glycine max] Length = 642 Score = 72.8 bits (177), Expect = 1e-12 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 +HKFLLPKASTWA+VVQQ+CKP+ +RK+IS+CWSRL C Sbjct: 605 MHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 642 >XP_012573735.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Cicer arietinum] Length = 649 Score = 72.8 bits (177), Expect = 1e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFLLPKASTWALVVQ LCKP ++RK+I++CWSRLCC Sbjct: 612 LPKFLLPKASTWALVVQHLCKPMKVRKTINECWSRLCC 649 >GAU33588.1 hypothetical protein TSUD_359660 [Trifolium subterraneum] Length = 645 Score = 71.6 bits (174), Expect = 4e-12 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFLLPK STWAL VQQLCKP ++RK+IS+CW+RLCC Sbjct: 608 LKKFLLPKPSTWALAVQQLCKPMKVRKTISECWTRLCC 645 >XP_007138861.1 hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] ESW10855.1 hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] Length = 645 Score = 70.9 bits (172), Expect = 7e-12 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRL 109 LHKFLLPKASTWA++VQQLCKP+R+RK IS+CWS+L Sbjct: 608 LHKFLLPKASTWAMIVQQLCKPKRVRKVISECWSKL 643 >GAU43169.1 hypothetical protein TSUD_301340 [Trifolium subterraneum] Length = 469 Score = 70.1 bits (170), Expect = 1e-11 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFLLPK STWAL QQLCKP ++RK+IS+CWSR+CC Sbjct: 432 LKKFLLPKPSTWALAAQQLCKPTKVRKTISECWSRMCC 469 >GAU43168.1 hypothetical protein TSUD_301350 [Trifolium subterraneum] Length = 761 Score = 70.1 bits (170), Expect = 1e-11 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFLLPK STWAL QQLCKP ++RK+IS+CWSR+CC Sbjct: 724 LKKFLLPKPSTWALAAQQLCKPTKVRKTISECWSRMCC 761 >XP_014498979.1 PREDICTED: uncharacterized protein LOC106760056 [Vigna radiata var. radiata] Length = 1464 Score = 69.3 bits (168), Expect = 2e-11 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 LHKFLLPKASTWA++VQQLCKP+ RK IS+CWS+L C Sbjct: 1427 LHKFLLPKASTWAMIVQQLCKPKNGRKVISECWSKLSC 1464 >XP_003594857.1 PPR containing plant-like protein [Medicago truncatula] AES65108.1 PPR containing plant-like protein [Medicago truncatula] Length = 647 Score = 67.4 bits (163), Expect = 1e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFLLPK STWAL VQQLCKP ++RK+IS+C SR+CC Sbjct: 610 LQKFLLPKPSTWALAVQQLCKPMKVRKTISECQSRMCC 647 >XP_017408274.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] XP_017408275.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] XP_017408276.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] KOM27871.1 hypothetical protein LR48_Vigan468s003300 [Vigna angularis] BAT80211.1 hypothetical protein VIGAN_02320600 [Vigna angularis var. angularis] Length = 645 Score = 67.0 bits (162), Expect = 1e-10 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRL 109 LHKFLLPKASTWA++V+QLCKP+ +RK IS+CWS+L Sbjct: 608 LHKFLLPKASTWAMIVKQLCKPKSVRKVISECWSKL 643 >OIW14265.1 hypothetical protein TanjilG_21405 [Lupinus angustifolius] Length = 594 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRL 109 LHKFLLPKASTWA+VVQQL KP++IR +I++CWSRL Sbjct: 557 LHKFLLPKASTWAIVVQQLYKPKKIRLAINECWSRL 592 >XP_019439321.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Lupinus angustifolius] XP_019439322.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X2 [Lupinus angustifolius] Length = 651 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRL 109 LHKFLLPKASTWA+VVQQL KP++IR +I++CWSRL Sbjct: 614 LHKFLLPKASTWAIVVQQLYKPKKIRLAINECWSRL 649 >XP_016171182.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Arachis ipaensis] XP_016171183.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Arachis ipaensis] XP_016171184.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Arachis ipaensis] Length = 661 Score = 62.0 bits (149), Expect = 9e-09 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLC 112 L KFLLPK STWA VV+ LCKP+++R++I +CWS+LC Sbjct: 624 LQKFLLPKGSTWATVVKHLCKPKKVRETIRECWSKLC 660 >XP_015937071.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Arachis duranensis] Length = 661 Score = 62.0 bits (149), Expect = 9e-09 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLC 112 L KFLLPK STWA VV+ LCKP+++R++I +CWS+LC Sbjct: 624 LQKFLLPKGSTWATVVKHLCKPKKVRETIRECWSKLC 660 >XP_018853395.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Juglans regia] Length = 665 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFL PKASTWA VVQ+LCKP++I+ +I CWS L C Sbjct: 628 LQKFLPPKASTWARVVQELCKPKKIQAAIDKCWSSLYC 665 >XP_016648698.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Prunus mume] XP_016648699.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Prunus mume] XP_016648700.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Prunus mume] XP_016648701.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Prunus mume] XP_016648702.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Prunus mume] Length = 664 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFL PKASTW VVQ+LCKP+++R +I CWS L C Sbjct: 627 LQKFLPPKASTWTRVVQELCKPKKVRAAIDKCWSSLYC 664 >KDP46790.1 hypothetical protein JCGZ_11161 [Jatropha curcas] Length = 588 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFL PKASTWA VVQ+LCKP++I+ I CWS L C Sbjct: 551 LQKFLPPKASTWARVVQELCKPKKIQAVIDKCWSNLYC 588 >XP_012065087.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Jatropha curcas] Length = 671 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFL PKASTWA VVQ+LCKP++I+ I CWS L C Sbjct: 634 LQKFLPPKASTWARVVQELCKPKKIQAVIDKCWSNLYC 671 >XP_017190750.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Malus domestica] Length = 666 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 2 LHKFLLPKASTWALVVQQLCKPQRIRKSISDCWSRLCC 115 L KFL PKAS W VVQ+LCKP+++R +I CWS L C Sbjct: 629 LKKFLPPKASVWTKVVQELCKPKKVRAAIDKCWSSLYC 666