BLASTX nr result
ID: Glycyrrhiza35_contig00032398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00032398 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAX19931.1 viral replicase [Nandina mosaic virus] 53 3e-06 >AAX19931.1 viral replicase [Nandina mosaic virus] Length = 1368 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 4 ENLASHTSLKVGHADLSTEQLRALHELGNTRLGGPLLPK 120 E+ +HTSLKV LS EQL ALHELGN+R GGP+LPK Sbjct: 463 ESDVTHTSLKVVPQSLSPEQLSALHELGNSRCGGPMLPK 501