BLASTX nr result
ID: Glycyrrhiza35_contig00032262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00032262 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRG98887.1 hypothetical protein GLYMA_18G104900 [Glycine max] 68 3e-11 XP_006602238.1 PREDICTED: uncharacterized protein LOC102670551 [... 68 3e-11 KHM99616.1 hypothetical protein glysoja_006459 [Glycine soja] 61 5e-09 KOM52240.1 hypothetical protein LR48_Vigan09g089900 [Vigna angul... 61 5e-09 XP_017436894.1 PREDICTED: uncharacterized protein LOC108343252 [... 61 6e-09 XP_006586066.1 PREDICTED: uncharacterized protein LOC102665055 i... 60 1e-08 XP_006586065.1 PREDICTED: uncharacterized protein LOC102665055 i... 60 1e-08 XP_014518932.1 PREDICTED: uncharacterized protein LOC106776115 [... 59 5e-08 JAU39191.1 Protein EMBRYONIC FLOWER 1, partial [Noccaea caerules... 50 3e-06 XP_007146374.1 hypothetical protein PHAVU_006G0351000g, partial ... 53 5e-06 JAU56484.1 hypothetical protein LE_TR777_c4_g1_i1_g.2143, partia... 50 5e-06 XP_006402749.1 hypothetical protein EUTSA_v10005808mg [Eutrema s... 53 5e-06 GAV65154.1 hypothetical protein CFOL_v3_08669 [Cephalotus follic... 53 5e-06 KYP47654.1 hypothetical protein KK1_030684 [Cajanus cajan] 52 1e-05 >KRG98887.1 hypothetical protein GLYMA_18G104900 [Glycine max] Length = 1228 Score = 67.8 bits (164), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELA 146 RSVDVFK WPFA L+R+E E+WLPPM++P+SR WSD LA Sbjct: 2 RSVDVFKCWPFAASGLSRDEAESWLPPMSIPESRQWSDNLA 42 >XP_006602238.1 PREDICTED: uncharacterized protein LOC102670551 [Glycine max] Length = 1244 Score = 67.8 bits (164), Expect = 3e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELA 146 RSVDVFK WPFA L+R+E E+WLPPM++P+SR WSD LA Sbjct: 18 RSVDVFKCWPFAASGLSRDEAESWLPPMSIPESRQWSDNLA 58 >KHM99616.1 hypothetical protein glysoja_006459 [Glycine soja] Length = 387 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RSVDVFK WPF L+R +VE+ LPPM+ PKS+ WSDELA L Sbjct: 13 RSVDVFKCWPFPTAGLSRNQVESRLPPMSTPKSQQWSDELAGL 55 >KOM52240.1 hypothetical protein LR48_Vigan09g089900 [Vigna angularis] Length = 401 Score = 61.2 bits (147), Expect = 5e-09 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 R+VDVFK WPFA ++R E E+WLPPMTVPK WSDE L Sbjct: 13 RAVDVFKCWPFAAEGVSRWEAESWLPPMTVPKFSGWSDEFVEL 55 >XP_017436894.1 PREDICTED: uncharacterized protein LOC108343252 [Vigna angularis] BAT88975.1 hypothetical protein VIGAN_05262800 [Vigna angularis var. angularis] Length = 1356 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 R+VDVFK WPFA ++R E E+WLPPMTVPK WSDE L Sbjct: 18 RAVDVFKCWPFAAEGVSRWEAESWLPPMTVPKFSGWSDEFVEL 60 >XP_006586066.1 PREDICTED: uncharacterized protein LOC102665055 isoform X2 [Glycine max] KRH46080.1 hypothetical protein GLYMA_08G310800 [Glycine max] Length = 1334 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RSVDVFK WPF L+R +VE+ LPPM+ PK R WSDELA L Sbjct: 18 RSVDVFKCWPFPAAGLSRNQVESRLPPMSTPKLRRWSDELAEL 60 >XP_006586065.1 PREDICTED: uncharacterized protein LOC102665055 isoform X1 [Glycine max] Length = 1348 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RSVDVFK WPF L+R +VE+ LPPM+ PK R WSDELA L Sbjct: 18 RSVDVFKCWPFPAAGLSRNQVESRLPPMSTPKLRRWSDELAEL 60 >XP_014518932.1 PREDICTED: uncharacterized protein LOC106776115 [Vigna radiata var. radiata] Length = 1355 Score = 58.5 bits (140), Expect = 5e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSD 155 R+VDVFK WPFA ++R E E+WLPPMTVPK WSD Sbjct: 18 RAVDVFKCWPFAAEGVSRWEAESWLPPMTVPKFSGWSD 55 >JAU39191.1 Protein EMBRYONIC FLOWER 1, partial [Noccaea caerulescens] Length = 77 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RSV+V K WPF+ G+ T + + + LPP+TV K RWWS ELA L Sbjct: 18 RSVEVRKCWPFS-GDATGDLIHSLLPPITVAKFRWWSHELASL 59 >XP_007146374.1 hypothetical protein PHAVU_006G0351000g, partial [Phaseolus vulgaris] ESW18368.1 hypothetical protein PHAVU_006G0351000g, partial [Phaseolus vulgaris] Length = 385 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 R+VDVFK WPFA ++R E E+ LPPMTVPK W +E L Sbjct: 13 RTVDVFKCWPFAADGVSRWEAESSLPPMTVPKMSGWENEFGGL 55 >JAU56484.1 hypothetical protein LE_TR777_c4_g1_i1_g.2143, partial [Noccaea caerulescens] Length = 109 Score = 50.4 bits (119), Expect = 5e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RSV+V K WPF+ G+ T + + + LPP+TV K RWWS ELA L Sbjct: 4 RSVEVRKCWPFS-GDATGDLIHSLLPPITVAKFRWWSHELASL 45 >XP_006402749.1 hypothetical protein EUTSA_v10005808mg [Eutrema salsugineum] ESQ44202.1 hypothetical protein EUTSA_v10005808mg [Eutrema salsugineum] Length = 729 Score = 52.8 bits (125), Expect = 5e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -1 Query: 271 TRSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 TRSV++ K WPF+ GE T + + + LPP+TV K RWWS ELA L Sbjct: 13 TRSVELRKCWPFS-GEFTGDLIRSLLPPITVSKFRWWSHELASL 55 >GAV65154.1 hypothetical protein CFOL_v3_08669 [Cephalotus follicularis] Length = 1207 Score = 52.8 bits (125), Expect = 5e-06 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 5/45 (11%) Frame = -1 Query: 268 RSVDVFKSWPFAV-----GELTREEVEAWLPPMTVPKSRWWSDEL 149 RSV+V K WPF+ E+T+E VE LPP+TVP+ RWWS EL Sbjct: 18 RSVNVAKCWPFSGHDNTDDEITKERVEVLLPPITVPRFRWWSHEL 62 >KYP47654.1 hypothetical protein KK1_030684 [Cajanus cajan] Length = 244 Score = 51.6 bits (122), Expect = 1e-05 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 268 RSVDVFKSWPFAVGELTREEVEAWLPPMTVPKSRWWSDELAVL 140 RS+DVFK WPF ++R E + LPPM +PKSR W +LA L Sbjct: 13 RSLDVFKCWPFVAAGVSRHEAHSSLPPMMLPKSRRWYGDLARL 55