BLASTX nr result
ID: Glycyrrhiza35_contig00032140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00032140 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value O81117.2 RecName: Full=Cytochrome P450 94A1; AltName: Full=P450-... 46 3e-06 >O81117.2 RecName: Full=Cytochrome P450 94A1; AltName: Full=P450-dependent fatty acid omega-hydroxylase AAD10204.1 CYP94A1 [Vicia sativa] Length = 514 Score = 46.2 bits (108), Expect(2) = 3e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -3 Query: 217 LSDIVQIVPATTFTLDCSVRKHQFNSGNHATLQHILKKELA 95 LSDIVQI P+ TF LD ++ K Q +GN +T+QHILK + + Sbjct: 71 LSDIVQISPSATFQLDGTLGKRQIITGNPSTVQHILKNQFS 111 Score = 32.0 bits (71), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 110 QKGTCFTGTLSNFLASEIFDTELSN 36 QKGT FT TLS+FL + IF+T N Sbjct: 114 QKGTTFTNTLSDFLGTGIFNTNGPN 138