BLASTX nr result
ID: Glycyrrhiza35_contig00032008
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00032008 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013456512.1 PPR containing plant-like protein [Medicago trunc... 72 2e-12 XP_004505808.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 OIV99570.1 hypothetical protein TanjilG_17380 [Lupinus angustifo... 66 1e-10 AMK48011.1 putative pentatricopeptide repeat-containing protein ... 66 1e-10 XP_019465125.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_016193129.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 XP_015952707.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 >XP_013456512.1 PPR containing plant-like protein [Medicago truncatula] KEH30543.1 PPR containing plant-like protein [Medicago truncatula] Length = 606 Score = 71.6 bits (174), Expect = 2e-12 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQAE*NKGFE 160 IEV GS+HEFKAFDHSH+E S VYLMLENL LQ+K+V QA+ N+GF+ Sbjct: 552 IEVAGSMHEFKAFDHSHSEFSCVYLMLENLILQMKMVDQAQWNEGFD 598 >XP_004505808.1 PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Cicer arietinum] Length = 611 Score = 70.9 bits (172), Expect = 3e-12 Identities = 37/58 (63%), Positives = 43/58 (74%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQAE*NKGFEPNI*QSLMWVE 127 IEV G IHEFKAFDHSHNE SGVYLMLENL QLKLV Q + ++ F + ++MW E Sbjct: 555 IEVAGLIHEFKAFDHSHNELSGVYLMLENLISQLKLVDQDQWSEDF--GLRSTMMWAE 610 >OIV99570.1 hypothetical protein TanjilG_17380 [Lupinus angustifolius] Length = 493 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQ 184 IEV+G IHEFKAFDHSHNESSGVY +L+NL LQL L GQ Sbjct: 438 IEVNGLIHEFKAFDHSHNESSGVYSILDNLILQLNLAGQ 476 >AMK48011.1 putative pentatricopeptide repeat-containing protein [Lupinus angustifolius] Length = 511 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQ 184 IEV+G IHEFKAFDHSHNESSGVY +L+NL LQL L GQ Sbjct: 456 IEVNGLIHEFKAFDHSHNESSGVYSILDNLILQLNLAGQ 494 >XP_019465125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Lupinus angustifolius] Length = 606 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQ 184 IEV+G IHEFKAFDHSHNESSGVY +L+NL LQL L GQ Sbjct: 551 IEVNGLIHEFKAFDHSHNESSGVYSILDNLILQLNLAGQ 589 >XP_016193129.1 PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Arachis ipaensis] Length = 523 Score = 65.1 bits (157), Expect = 3e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQAE 178 IEV+G IHEFKAFDHSHNESS VY ML+NL LQLKLV E Sbjct: 476 IEVNGLIHEFKAFDHSHNESSDVYSMLDNLVLQLKLVRVCE 516 >XP_015952707.1 PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Arachis duranensis] Length = 523 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -2 Query: 300 IEVDGSIHEFKAFDHSHNESSGVYLMLENLTLQLKLVGQAE 178 IEV+G IHEFKAFDHSHNESS VY ML+ L LQLKLV E Sbjct: 476 IEVNGLIHEFKAFDHSHNESSDVYSMLDKLVLQLKLVRVCE 516